KEGG   Homo sapiens (human): 7574Help
Entry
7574              CDS       T01001                                 

Gene name
ZNF26, HEL-179, KOX20
Definition
(RefSeq) zinc finger protein 26
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7574 (ZNF26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7574 (ZNF26)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7574 (ZNF26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 C1_4 Zn-ribbon_8 zf_UBZ CpXC zinc_ribbon_15 IBR zf-C2H2_11 zf-met
Motif
Other DBs
NCBI-GeneID: 7574
NCBI-ProteinID: NP_062537
OMIM: 194537
HGNC: 13053
Ensembl: ENSG00000198393
Vega: OTTHUMG00000167936
Pharos: P17031(Tdark)
UniProt: P17031 V9HW07
Position
12q24.33
AA seq 533 aa AA seqDB search
MATSFRTASCWGLLSFKDISMEFTWDEWQLLDSTQKYLYRDVILENYHNLISVGYHGTKP
DLIFKLEQGEDPWIINAKISRQSCPDGWEEWYQNNQDELESIERSYACSVLGRLNLSKTH
DSSRQRLYNTRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIEKNCVCSECG
KAFRCKSQLIVHLRIHTGERPYECSKCERAFSAKSNLNAHQRVHTGEKPYSCSECEKVFS
FRSQLIVHQEIHTGGKPYGCSECGKAYSWKSQLLLHQRSHTGVKPYECSECGKAFSLKSP
FVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKAFNMKTQLIVH
QGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTH
TGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEK
PFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagtttccggacagcttcgtgctggggattattgtcattcaaggatatatct
atggagttcacctgggatgaatggcagctactggattctacacagaagtacctgtacaga
gatgtgatattggaaaactatcataacctgatatcagtggggtatcatggtaccaagcct
gacttaatcttcaagttggaacaaggagaagatccatggataataaatgccaaaatttcc
aggcagagctgtccagatggctgggaagaatggtaccagaacaatcaagatgagcttgag
agtattgaaagaagctatgcttgtagtgtgttgggaagacttaatctgagcaaaacccat
gattcttcaagacagagactctataacacacgtggaaaaagtttgacacaaaactcagct
ccaagcagaagttatttaagaaagaatcctgataagtttcatggttatgaagaaccatat
tttcttaagcatcaaagagctcatagcatagaaaaaaactgtgtgtgtagtgaatgtggg
aaagcttttcgttgtaagtcacagctcattgtacatctcagaattcatacaggagagaga
ccttatgaatgcagtaaatgtgaaagagccttcagtgccaagtcaaaccttaatgctcat
cagagagttcatacaggagaaaaaccctactcatgtagtgagtgcgagaaggtcttctct
ttcaggtcacagctcattgtccatcaggaaattcacacaggagggaaaccctatggctgc
agtgaatgtgggaaagcctacagttggaaatcacagcttcttttacaccagagaagtcac
acaggagtgaaaccgtatgaatgcagcgaatgtgggaaagcctttagtttgaagtctcca
ttcgttgtacaccagagaactcatacaggagtgaaaccccataaatgcagtgaatgtggg
aaagcctttaggagtaagtcctatctccttgttcacatccgaatgcatacaggagaaaaa
ccctatcaatgcagtgattgtgggaaagccttcaatatgaagacacaactcattgtacat
cagggagttcacacaggaaataatccttatcaatgcggtgaatgtgggaaagcctttggt
aggaaggaacagctcactgcacatctgagagctcatgcaggagagaagccctatggatgc
agtgaatgtgggaaggctttcagcagcaagtcataccttgttatacataggagaacacac
accggagagagaccctatgaatgtagtttgtgtgagagagccttttgtggaaaatcacag
ctgattatacatcagagaactcattcaactgagaagccctatgaatgcaatgaatgtgaa
aaagcctaccctaggaaggcatcacttcagatacaccagaaaactcattcgggagagaaa
ccttttaaatgcagtgaatgtggaaaagccttcactcagaagtcatctctcagtgaacat
cagagagttcacaccggagagaaaccatggaaatgctctgaatgtgggaaatccttctgt
tggaattcagggcttcgtatacatcggaagactcataaatga

DBGET integrated database retrieval system