KEGG   Homo sapiens (human): 7584
Entry
7584              CDS       T01001                                 
Symbol
ZNF35, HF.10, HF10, Zfp105
Name
(RefSeq) zinc finger protein 35
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_6 C1_4 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 7584
NCBI-ProteinID: NP_003411
OMIM: 194533
HGNC: 13099
Ensembl: ENSG00000169981
UniProt: P13682
Position
3:44646506..44660791
AA seq 527 aa
MTAELREAMALAPWGPVKVKKEEEEEENFPGQASSQQVHSENIKVWAPVQGLQTGLDGSE
EEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGAETKNLQ
LLVPKTEICEEAEKPLIISERIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVN
DCHLPESFKEEENQKCKKSGGKYSLNSGAVKNPKTQLGQKPFTCSVCGKGFSQSANLVVH
QRIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIH
SLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEK
PFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDC
SECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECG
KAFRQRSSLTVHQRTHTGEKPYECEKCGAAFISNSHLMRHHRTHLVE
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgactgcagaattgagagaagccatggccctagccccatggggcccagtgaaggtgaaa
aaggaggaggaagaagaagaaaacttcccaggtcaggcatccagccaacaagtgcactcc
gagaacatcaaagtctgggccccagtgcagggtcttcagacaggccttgatggatcagaa
gaggaagaaaagggtcagaacatatcctgggatatggcggtagtcctgaaagcaactcag
gaggcacctgctgcttcaacccttggcagctactcattaccagggactctggccaagagt
gagatactggagactcatgggaccatgaactttctaggtgctgaaaccaagaacctacag
ttactggttccaaaaactgagatatgtgaggaagctgaaaaacccctcatcatatcagaa
agaatccagaaagctgatcctcaaggacctgagttaggagaagcttgtgaaaagggaaac
atgttaaagaggcagagaataaagagagaaaagaaagatttcagacaagtgatagtgaat
gactgtcacttacctgaaagcttcaaagaagaggaaaaccagaaatgtaagaaatctgga
ggaaaatatagccttaattctggcgctgttaaaaatccaaaaacccagcttggacaaaag
ccttttacgtgtagcgtgtgtgggaaaggatttagtcagagtgcaaacctcgttgtgcat
cagcgaatccacactggagagaaaccctttgaatgtcatgagtgtgggaaggccttcatt
cagagtgcaaacctcgttgtgcatcagagaatccacactggacagaaaccttatgtttgc
tcaaaatgtgggaaagccttcactcagagttcaaatctgactgtacatcaaaaaatccac
tccttagaaaaaacttttaagtgcaatgaatgtgagaaagcctttagttacagctcacaa
cttgctcggcaccagaaagtccacattacggaaaaatgctatgaatgtaatgaatgtggg
aaaacatttactaggagctcaaacctcattgtccaccagaggatccacactggggagaag
ccctttgcctgtaacgactgtggcaaagcctttacccagagtgcaaatcttattgtacat
cagcgaagccatactggtgagaagccatatgagtgtaaagagtgtgggaaagcctttagt
tgtttttcacaccttattgtgcaccagagaattcacactgcagagaaaccttacgactgc
agcgaatgtgggaaagccttcagtcagctctcttgccttattgtccaccagagaattcac
agtggagatcttccttacgtgtgtaatgaatgtgggaaggccttcacatgtagctcatac
ctacttattcatcagagaattcataatggagaaaaaccttacacatgtaatgagtgtggg
aaggccttcagacagaggtcgagcctcaccgtgcaccagagaacccacactggggagaag
ccctatgaatgtgagaagtgtggtgcagctttcatttccaactcacacctcatgcgacac
catagaacccatcttgttgaataa

DBGET integrated database retrieval system