KEGG   Homo sapiens (human): 7586
Entry
7586              CDS       T01001                                 

Gene name
ZKSCAN1, KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33
Definition
(RefSeq) zinc finger with KRAB and SCAN domains 1
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7586 (ZKSCAN1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7586 (ZKSCAN1)
SSDB
Motif
Pfam: zf-H2C2_2 SCAN zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_11 C1_4 MRP-S23 DUF5830 zinc_ribbon_15 GATA
Other DBs
NCBI-GeneID: 7586
NCBI-ProteinID: NP_001333510
OMIM: 601260
HGNC: 13101
Ensembl: ENSG00000106261
Vega: OTTHUMG00000156534
Pharos: P17029(Tbio)
UniProt: P17029
Position
7q22.1
AA seq 563 aa
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHF
KHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKE
FGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSL
SSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPASLDAFGAFLKSCV
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgatgactgctgaatcacgggaagccacgggtctgtccccacaggctgcacaggagaag
gatggtatcgtaatagtgaaggtggaagaggaagatgaggaagaccacatgtgggggcag
gattccaccctacaggacacgcctcctccagacccagagatattccgccaacgcttcagg
cgcttctgttaccagaacacttttgggccccgagaggctctcagtcggctgaaggaactt
tgtcatcagtggctgcggccagaaataaacaccaaggaacagatcctggagcttctggtg
ctagagcagtttctttccatcctgcccaaggagctccaggtctggctgcaggaataccgc
cccgatagtggagaggaggccgtgacccttctagaagacttggagcttgatttatcagga
caacaggtcccaggtcaagttcatggacctgagatgctcgcaagggggatggtgcctctg
gatccagttcaggagtcctcgagctttgaccttcatcacgaggccacccagtcccacttc
aaacattcgtctcggaaaccccgcctcttacagtcacgagctcttcctgctgcccacatt
cctgcaccccctcatgagggtagtcccagagaccaggcgatggcatctgcactattcaca
gcggattcccaggcaatggtgaagatcgaggacatggctgtgtccctcattctggaggaa
tggggatgtcagaatctggctcggaggaatctcagtagggacaacaggcaggagaattat
gggagcgcatttccccagggtggtgaaaacaggaatgagaacgaggagtcaacctcaaag
gctgaaacctcggaagattcagcatcacgcggggagacaacaggaagatcccagaaagag
tttggagagaaacgtgaccaggagggcaaaacaggagaaagacagcagaaaaaccctgag
gagaaaaccaggaaagagaaaagagattcagggccagctataggaaaggacaaaaaaacc
atcacaggagagagaggtccaagggagaaggggaaaggattgggaagaagcttcagtctg
agctccaacttcaccacccctgaagaagttcccacgggaacaaagtctcacagatgtgat
gaatgtggtaaatgcttcacgagaagttcaagccttatccgccataaaataatccacact
ggagaaaagccctatgaatgtagtgagtgtgggaaagccttcagtcttaactccaacctt
gtcctgcatcagaggatccacacaggagagaaacctcatgaatgtaacgagtgtggcaag
gccttcagccacagttccaatctcatcctccatcagcgcatccactctggagagaaacct
tatgaatgtaatgagtgcgggaaggccttcagccagagctcggacctcaccaagcatcag
agaattcacacgggggagaaaccctatgaatgtagtgaatgtggaaaagctttcaaccga
aactcatacctgattttgcatcggagaattcacactcgagaaaagccctacaagtgcact
aagtgtggcaaggccttcacccgcagctccaccctcactctgcatcacagaatccatgcc
agagagagagcctctgagtacagcccagcctcccttgatgcatttggcgcgttcctgaaa
agttgtgtgtaa

DBGET integrated database retrieval system