KEGG   Homo sapiens (human): 7587
Entry
7587              CDS       T01001                                 

Gene name
ZNF37A, KOX21, ZNF37
Definition
(RefSeq) zinc finger protein 37A
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7587 (ZNF37A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7587 (ZNF37A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7587 (ZNF37A)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 C1_4 zf-H2C2_5 DUF3506 Siva zinc_ribbon_15
Other DBs
NCBI-GeneID: 7587
NCBI-ProteinID: NP_001007095
OMIM: 616085
HGNC: 13102
Ensembl: ENSG00000075407
Vega: OTTHUMG00000191777
Pharos: P17032(Tdark)
UniProt: P17032
Position
10p11.1
AA seq 561 aa
MITSQGSVSFRDVTVGFTQEEWQHLDPAQRTLYRDVMLENYSHLVSVGYCIPKPEVILKL
EKGEEPWILEEKFPSQSHLELINTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEY
NKNGNSFWLNEDLIWHQKIKNWEQSFEYNECGKAFPENSLFLVHKRGYTGQKTCKYTEHG
KTCDMSFFITHQQTHPRENHYGNECGENIFEESILLEHQSVYPFSQKLNLTPIQRTHSIN
NIIEYNECGTFFSEKLVLHLQQRTHTGEKPYECHECGKTFTQKSAHTRHQRTHTGGKPYE
CHECGKTFYKNSDLIKHQRIHTGERPYGCHECGKSFSEKSTLTQHQRTHTGEKPYECHEC
GKTFSFKSVLTVHQKTHTGEKPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSF
SEKSTLTKHLRTHTGEKPYECIQCGKFFCYYSGFTEHLRRHTGEKPFGCNECGKTFRQKS
ALIVHQRTHIRQKPYGCNQCGKSFCVKSKLIAHHRTHTGEKPYECNVCGKSFYVKSKLTV
HQRIHLGRNPINVVNEGNYSG
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgatcacatcccagggatcagtgtcgtttagggatgtgactgtgggcttcactcaagag
gagtggcagcatctggaccctgctcagaggaccctgtacagggatgtgatgctggagaac
tacagccaccttgtctcagtagggtattgcattcctaaaccagaagtgattctcaagttg
gagaaaggcgaggagccatggatattagaggaaaaatttccaagccagagtcatctggaa
ttaattaataccagtagaaactattcaataatgaagttcaatgagtttaacaaaggtgga
aaatgtttctgtgatgaaaagcatgaaataattcattctgaagaggaaccttctgaatat
aataaaaatgggaacagcttctggctgaatgaagacctcatttggcatcagaaaattaaa
aattgggaacaatcttttgaatacaatgaatgtgggaaagctttccctgagaattcactc
ttccttgtacataagagaggttacacaggacagaaaacctgcaaatatactgaacatggg
aaaacctgtgatatgtcatttttcatcactcatcagcaaacacatccaagagaaaaccac
tatggtaatgaatgtggagaaaatatctttgaggaatccattctccttgaacatcagagt
gtttacccattcagccagaagttaaatctcactccaattcagagaacccactcaattaac
aatattattgaatataatgagtgtggaacatttttcagtgaaaaattagtccttcattta
caacagagaacacatacaggagaaaaaccttatgaatgtcatgaatgtggaaaaaccttc
acccagaagtcagcccacacaagacatcagagaacacacacagggggaaaaccctatgaa
tgtcatgaatgtgggaagaccttctataagaattcagacctcattaaacatcaaagaatt
catacaggggagagaccttatggatgtcatgaatgtgggaaatccttcagtgaaaagtca
acccttactcaacatcaaagaacgcacacaggggagaaaccatatgaatgtcatgaatgt
gggaaaaccttctcatttaagtcagtccttactgtgcatcagaaaacacacacaggggag
aagccctatgaatgctatgcatgtgggaaagcctttctcagaaaatcagacctcattaaa
catcaaagaatacacacaggtgaaaaaccttatgaatgtaatgaatgtgggaagtcattc
tctgagaagtcaacccttactaaacatctaagaactcacacaggtgagaaaccttatgaa
tgtattcagtgtggaaaatttttctgctactactccggtttcacagaacatctgagaaga
cacacaggggagaaaccttttggatgtaatgaatgtgggaaaaccttccgtcagaagtca
gccctaattgttcaccagagaactcatataagacagaaaccctatggatgtaatcaatgt
ggaaaatcattctgtgtgaagtcaaaactcattgcacatcatagaacacacacaggggag
aaaccctatgaatgtaatgtttgtggaaaatcattctatgttaagtcaaaactaactgta
catcagagaatacacttggggagaaaccctataaatgtagtaaacgagggaaattactct
gggtga

DBGET integrated database retrieval system