KEGG   Homo sapiens (human): 7589Help
Entry
7589              CDS       T01001                                 

Gene name
ZSCAN21, NY-REN-21, ZNF38, Zipro1
Definition
(RefSeq) zinc finger and SCAN domain containing 21
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7589 (ZSCAN21)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7589 (ZSCAN21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 SCAN zf-C2H2 zf-C2H2_4 zf-C2H2_11 Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zinc_ribbon_15 zf-C2H2_6 DZR PknG_rubred zf-met HypA DUF3720
Motif
Other DBs
NCBI-GeneID: 7589
NCBI-ProteinID: NP_666019
OMIM: 601261
HGNC: 13104
Ensembl: ENSG00000166529
Vega: OTTHUMG00000154583
Pharos: Q9Y5A6(Tdark)
UniProt: Q9Y5A6
Position
7q22.1
AA seq 473 aa AA seqDB search
MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLPSLEMFRQRFRQFGYHDTPGPR
EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLL
EDLERELDEPGHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYI
QESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQ
CVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHT
GEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPY
QCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKE
CGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaggtactaggcatggccccagttctgggccctaggcctccacaggagcag
gtggggcctctgatggtaaaagtcgaggagaaagaagagaaaggcaagtaccttcctagc
ctggagatgttccgccagcgcttcaggcagtttgggtaccatgatacccctggaccccga
gaggccctgagccaactccgggtgctctgctgtgagtggctgaggcccgagatccacacc
aaggagcagatcctggagctactggtgctggagcagttcctgaccatcctgccccaggag
ctccaggcctgggtgcaggagcattgcccggagagcgctgaagaggctgtcactctcctc
gaagatctggagcgggaactggatgagccaggacaccaggtctcaactcctccaaacgaa
cagaaaccggtgtgggagaagatatcctcctcaggaactgcaaaggaatccccgagcagc
atgcagccacagcccttggagaccagtcacaaatacgagtcttgggggcccctgtacatc
caagagtctggtgaggagcaggagttcgctcaagatccaagaaaggtccgagattgcaga
ttgagtacccagcacgaggaatcagcagatgagcagaaaggttctgaagcagaggggctc
aaaggggatataatttctgtgattatcgccaataaacctgaggccagcttagagaggcag
tgcgtaaaccttgaaaatgaaaaaggaacaaaaccccctcttcaagaggcaggctccaag
aaaggtagagaatcagttcctactaaacctaccccaggagagagacgttatatatgtgct
gaatgtggcaaagcctttagtaatagctcaaatctcaccaaacacaggagaacacacact
ggggagaaaccttacgtgtgcaccaagtgtgggaaagctttcagccacagctcaaacctc
accctccactacagaacacacttggtggaccggccctatgactgtaagtgtggaaaagct
tttgggcagagctcagaccttcttaaacatcagagaatgcacacagaagaggcgccatat
cagtgcaaagattgtggcaaggctttcagcgggaaaggcagcctcattcgtcactatcgg
atccacactggggagaagccttatcagtgtaacgaatgtgggaagagcttcagtcagcat
gcgggcctcagctcccaccagagactccacaccggagagaagccatataagtgtaaggag
tgtgggaaagccttcaaccacagctccaacttcaataaacaccacagaatccacaccggg
gaaaagccctactggtgtcatcactgtggaaagaccttctgtagcaagtccaatctttcc
aaacatcagcgagtccacactggagagggagaagcaccgtaa

DBGET integrated database retrieval system