KEGG   Homo sapiens (human): 7594
Entry
7594              CDS       T01001                                 

Gene name
ZNF43, HTF6, KOX27, ZNF39L1
Definition
(RefSeq) zinc finger protein 43
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7594 (ZNF43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7594 (ZNF43)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    7594 (ZNF43)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf_UBZ XPA_N KRAB Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_8 zinc_ribbon_15 C1_4 zf-AN1 PknG_rubred
Other DBs
NCBI-GeneID: 7594
NCBI-ProteinID: NP_003414
OMIM: 603972
HGNC: 13109
Ensembl: ENSG00000198521
Vega: OTTHUMG00000128543
Pharos: P17038(Tdark)
UniProt: P17038
Position
19p12
AA seq 809 aa
MGPLTFMDVAIEFCLEEWQCLDIAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEK
EPWEPMRRHEMVAKPPVMCSHFTQDFWPEQHIKDPFQKATLRRYKNCEHKNVHLKKDHKS
VDECKVHRGGYNGFNQCLPATQSKIFLFDKCVKAFHKFSNSNRHKISHTEKKLFKCKECG
KSFCMLPHLAQHKIIHTRVNFCKCEKCGKAFNCPSIITKHKRINTGEKPYTCEECGKVFN
WSSRLTTHKKNYTRYKLYKCEECGKAFNKSSILTTHKIIRTGEKFYKCKECAKAFNQSSN
LTEHKKIHPGEKPYKCEECGKAFNWPSTLTKHKRIHTGEKPYTCEECGKAFNQFSNLTTH
KRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKCEECGKAFKWSSKLTEHKLTH
TGEKPYKCEECGKAFNWPSTLTKHNRIHTGEKPYKCEVCGKAFNQFSNLTTHKRIHTAEK
PYKCEECGKAFSRSSNLTKHKKIHIEKKPYKCEECGKAFKWSSKLTEHKITHTGEKPYKC
EECGKAFNHFSILTKHKRIHTGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECG
KAFTQSSNLTTHKKIHTGGKPYKCEECGKAFNQFSTLTKHKIIHTEEKPYKCEECGKAFK
WSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIHTGEKPYKCEKCGKAFNRSSN
LIEHKKIHTGEQPYKCEECGKAFNYSSHLNTHKRIHTKEQPYKCKECGKAFNQYSNLTTH
NKIHTGEKLYKPEDVTVILTTPQTFSNIK
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgggaccattgacatttatggatgtggccatagaattctgtctggaggagtggcaatgc
ctggacattgcacagcagaatttatataggaatgtgatgttagagaactacagaaacctg
gtcttcctgggtattgctgtctctaagccagacctgatcacctgtctggagcaagaaaaa
gagccttgggagcctatgaggagacatgaaatggtagccaaacccccagttatgtgttct
cattttacccaagacttttggccagagcagcatataaaagatcctttccaaaaagcgaca
ctgagaagatataaaaactgtgaacataaaaatgtacatttaaaaaaagaccataaaagt
gtggatgagtgtaaggtgcacagaggaggttataatggatttaaccaatgtttgccagct
acccagagcaaaatatttctatttgataaatgtgtgaaagcctttcataaattttcaaat
tcaaacagacataagataagccatactgaaaaaaaacttttcaaatgcaaagaatgtggc
aaatcattttgcatgcttccacatctagctcaacataaaataattcataccagagtgaat
ttctgcaaatgtgaaaaatgtggaaaagcttttaactgcccttcaatcatcactaaacat
aagagaattaatactggagagaaaccctacacatgtgaagaatgtggcaaagtctttaat
tggtcctcacgccttactacacataaaaaaaattatactagatacaaactctacaaatgt
gaagaatgtggcaaagcttttaacaagtcctcaatccttactacccataagataattcgc
actggagagaaattctacaaatgtaaagaatgtgccaaagcttttaaccaatcctcaaac
cttactgaacataagaaaattcatcctggagagaaaccttacaaatgtgaagaatgtggc
aaagcctttaactggccctcaactcttactaaacataagagaattcatactggagagaaa
ccctacacatgtgaagaatgtggcaaagcctttaaccagttctcaaaccttactacacat
aagagaatccatactgcagagaaattctataaatgtacagaatgtggtgaagcttttagc
cggtcctcaaaccttactaaacataagaaaattcatactgaaaagaaaccctacaaatgt
gaagaatgtggcaaagcttttaagtggtcctcaaagcttactgaacataagttaactcat
actggagagaaaccctacaaatgtgaagaatgtggcaaagcctttaactggccctcaacc
cttactaaacataacagaattcatactggagagaaaccctacaaatgtgaagtatgtggc
aaagcctttaaccagttctcaaaccttactacacataagagaattcatactgcagaaaaa
ccgtacaaatgtgaagaatgtggcaaagcttttagccggtcctcaaaccttactaaacat
aagaaaattcacattgaaaagaaaccctacaaatgtgaagaatgtggcaaagcttttaag
tggtcctcaaagcttactgaacataagataactcatactggagagaaaccctacaaatgt
gaagaatgtggcaaagcttttaaccatttctcaatccttaccaaacataagaggattcat
actggagagaaaccctacaagtgtgaagaatgtggcaaagcttttacccaatcctcaaac
cttactacacataagaaaattcatactggagagaaattctacaaatgtgaagaatgtggc
aaagcttttacccaatcttcaaaccttactacacataaaaaaattcatactggaggaaaa
ccctacaaatgtgaagaatgtggcaaagcttttaaccagttctcaactcttactaaacat
aagataattcacactgaggagaaaccctacaaatgtgaagaatgtggcaaagcctttaag
tggtcctcaacccttactaaacataagataattcatactggagagaaaccctacaaatgt
gaagaatgtggcaaagcttttaaactgtcctcaaccctttctacacataagattattcat
actggagagaaaccctacaaatgtgaaaaatgtggcaaagcttttaaccgatcctcaaac
cttattgaacataagaaaattcatactggagagcaaccctacaaatgtgaagaatgtggc
aaagcatttaactattcctcacaccttaatacacataagagaattcatactaaagagcaa
ccctacaaatgtaaagaatgtggcaaagctttcaaccaatattcaaaccttactacacat
aacaaaattcatactggagagaaactctacaaacctgaagatgtgacagtgattttgaca
acacctcaaactttttcaaacataaaataa

DBGET integrated database retrieval system