KEGG   Homo sapiens (human): 7596
Entry
7596              CDS       T01001                                 

Gene name
ZNF45, KOX5, ZNF13
Definition
(RefSeq) zinc finger protein 45
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7596 (ZNF45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7596 (ZNF45)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7596 (ZNF45)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf_UBZ Zn-ribbon_8 zf-C2H2_6 C1_4 C1_1 zf-met zf-AN1 zf-trcl
Other DBs
NCBI-GeneID: 7596
NCBI-ProteinID: NP_003416
OMIM: 194554
HGNC: 13111
Ensembl: ENSG00000124459
Vega: OTTHUMG00000182189
Pharos: Q02386(Tdark)
UniProt: Q02386
Position
19q13.31
AA seq 682 aa
MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLE
REEKLWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQD
SVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQ
INQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQR
VPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHTG
KKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPY
KCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDA
CGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKG
FSRSSDLNVHCRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVG
SQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQ
AHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQR
VHADDEGDKDFPSSEDSHRKTR
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgacgaagtctaaggaggcagtgacattcaaggacgtggctgtggtcttctctgaggag
gagctgcaactgctggaccttgcccagaggaagctgtaccgagatgtgatgctggagaac
ttcaggaatgtggtctcagtggggcatcagtccacaccagatggcctaccacagttagag
agagaagaaaagctgtggatgatgaagatggcaacccagagagataactcctcaggagcc
aagaatctaaaagagatggagactcttcaagaagtaggattaaggtacctgcctcatgaa
gagcttttctgctcccagatctggcaacagattacaagagagttaatcaagtatcaagat
tctgtggtaaatattcaaagaacaggctgccagttggaaaaacgagatgatttgcactat
aaagatgagggattcagtaatcagagttcccatcttcaagttcacagagtccacactggt
gaaaaaccctacaaaggagaacattgtgtgaaaagtttcagctggagctctcatcttcaa
attaaccaaagggctcatgcaggagagaagccctacaaatgtgaaaaatgtgataatgcc
ttccgtcggttttcaagtcttcaagcccatcagagagtccacagtagagcaaaatcatac
acaaatgatgcaagttacaggagttttagtcagaggtcacatcttccccatcatcagaga
gttcccactggagagaatccatacaaatatgaagagtgtgggaggaatgttgggaaaagc
tcacattgtcaagctcctctgatagttcatacgggagagaaaccctataaatgtgaggag
tgtggggtgggcttcagtcagagatcatatcttcaagttcatctgaaagttcacactgga
aagaaaccatataagtgtgaagagtgtgggaagagcttcagttggcgttcacgactgcag
gctcatgagcgaatccacactggcgagaaaccatacaaatgcaatgcatgtggcaagagc
tttagttacagctcacaccttaatattcattgtagaatccacacaggagagaaaccctat
aagtgtgaggagtgtgggaaaggtttcagtgtgggttcacaccttcaggcccatcagata
agccacactggagagaagccatacaaatgtgaggagtgtgggaaaggcttctgccgggcc
tcaaatctgctggaccatcaaagaggccatactggagagaaaccgtatcagtgtgatgca
tgtggtaagggcttcagtcgtagctcagattttaacattcattttagagtccatacaggg
gaaaaaccctataaatgtgaggagtgtggcaagggcttcagccaggcctcaaatcttctg
gcccatcaaagaggccacactggagagaaaccctacaaatgtggtacatgtgggaagggc
ttcagtcggagctcagatcttaatgtacactgtagaatccacacaggagagaaaccctat
aaatgcgagaggtgtggtaaggccttcagtcagttctccagccttcaggtgcatcagaga
gttcacactggagagaaaccatatcagtgtgcagagtgtgggaagggcttcagtgtaggt
tcacagcttcaagcccatcagaggtgccacactggagagaaaccctatcaatgtgaggag
tgtgggaagggcttctgtcgggcctccaattttctggcacatcgtggagtccacacagga
gaaaaaccataccgatgtgatgtgtgtggtaagcgcttcagacagagatcctaccttcaa
gcccaccagagggtccacacaggagagagaccatacaaatgtgaggaatgtgggaaagtc
ttcagctggagctcataccttcaagcccatcaaagagttcacaccggagaaaaaccatac
aaatgtgaggagtgtgggaagggcttcagttggagctcaagtcttatcattcatcagcga
gtccatgctgatgatgagggtgacaaggactttccttcatcagaggattcacacaggaaa
actcgataa

DBGET integrated database retrieval system