KEGG   Homo sapiens (human): 761Help
Entry
761               CDS       T01001                                 

Gene name
CA3, CAIII, Car3
Definition
(RefSeq) carbonic anhydrase 3
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    761 (CA3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     761 (CA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 761
NCBI-ProteinID: NP_005172
OMIM: 114750
HGNC: 1374
Ensembl: ENSG00000164879
Vega: OTTHUMG00000164942
Pharos: P07451(Tclin)
UniProt: P07451 V9HWA3
Structure
PDB: 

Position
8q21.2
AA seq 260 aa AA seqDB search
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagtggggctacgccagtcacaacggtcctgaccactggcatgaacttttc
ccaaatgccaagggggaaaaccagtcgcccgttgagctgcatactaaagacatcaggcat
gacccttctctgcagccatggtctgtgtcttatgatggtggctctgccaagaccatcctg
aataatgggaagacctgccgagttgtatttgatgatacttatgataggtcaatgctgaga
gggggtcctctccctggaccctaccgacttcgccagtttcatcttcactggggctcttcg
gatgatcatggctctgagcacaccgtggatggagtcaagtatgcagcggagcttcatttg
gttcactggaacccgaagtataacacttttaaagaagccctgaagcagcgcgatgggatc
gctgtgattggcatttttctgaagataggacatgagaatggcgagttccagattttcctt
gatgcattggacaagattaagacaaagggcaaggaggcgcccttcacaaagtttgaccca
tcctgcctgttcccggcatgccgggactactggacctaccagggctcattcaccacgccg
ccctgcgaggaatgcattgtgtggctgctgctgaaggagcccatgaccgtgagctctgac
cagatggccaagctgcggagcctcctctccagtgctgagaacgagcccccagtgcctctt
gtgagcaactggcgacctccacagcctatcaataacagggtggtgagagcttccttcaaa
tga

DBGET integrated database retrieval system