KEGG   Homo sapiens (human): 7627
Entry
7627              CDS       T01001                                 

Gene name
ZNF75A
Definition
(RefSeq) zinc finger protein 75a
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7627 (ZNF75A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    7627 (ZNF75A)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_8 zf-H2C2_5 zf-Di19 C1_4 DUF3268 DZR zinc_ribbon_15 zf-met GAGA zinc_ribbon_5 zf-C2HE zinc_ribbon_4
Other DBs
NCBI-GeneID: 7627
NCBI-ProteinID: NP_694573
OMIM: 601473
HGNC: 13146
Ensembl: ENSG00000162086
Vega: OTTHUMG00000129356
Pharos: Q96N20(Tdark)
UniProt: Q96N20 Q68CU0
Position
16p13.3
AA seq 296 aa
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE
FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMH
RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ
RIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT
GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtatttttcccaggaagaatgggagttattggatcccactcagaaggccctctacaat
gatgtaatgcaggaaaactatgagactgtcatctctctagcattgtttgtgctccccaaa
cctaaagtgatctcctgtctagagcaaggggaagagccatgggttcaagtatccccggag
tttaaggatagtgccggaaaatctcctacagggttaaagctcaaaaacgacactgaaaat
catcagcctgtgtctctttctgacttagaaatacaagcatcagcaggcgtcatatcaaaa
aaggccaaagtaaaagttccccagaaaacagcaggcaaagaaaatcattttgatatgcac
agagtgggaaaatggcaccaagattttccagtgaagaaaagaaagaaactttcaacctgg
aaacaagagctgctcaaacttatggatcgtcacaagaaagattgtgcaagagagaagcct
tttaaatgtcaggaatgtgggaaaaccttcagagttagctctgaccttattaagcaccaa
agaattcacactgaagagaaaccctataaatgtcaacagtgtgataagaggtttagatgg
agttcagatcttaataagcacttaacaacacaccaaggaataaaaccatataaatgttca
tggtgtgggaaaagcttcagtcaaaatacaaatttacatacacaccaaagaactcataca
ggagaaaagcccttcacatgtcatgaatgtggaaaaaaattcagtcagaactcccacctt
attaaacaccggagaacccacacaggtgagcagccatatacttgtagcatatgcaggaga
aacttcagcaggcggtcaagccttcttagacaccagaaactccacctgtga

DBGET integrated database retrieval system