KEGG   Homo sapiens (human): 767558Help
Entry
767558            CDS       T01001                                 

Gene name
LUZP6, MPD6, MTPNUT
Definition
(RefSeq) leucine zipper protein 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 767558
NCBI-ProteinID: NP_001122091
OMIM: 611050
HGNC: 33955
Ensembl: ENSG00000267697
Vega: OTTHUMG00000180445
Pharos: Q538Z0(Tdark)
UniProt: Q538Z0
Position
7q33
AA seq 58 aa AA seqDB search
MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
attaaatcagtcatttcatatgcactatatcaagtacaaacaggtagtttacctgtttat
agtagtgtactaacaaagtctcccttgcagcttcagactgttatctataggcttatcgtt
caaatacagcacttgaatatcccaagtagttcttctacgcatagctcacctttctaa

DBGET integrated database retrieval system