KEGG   Homo sapiens (human): 768206Help
Entry
768206            CDS       T01001                                 

Gene name
PRCD, RP36
Definition
(RefSeq) photoreceptor disc component
  KO
K19637  progressive rod-cone degeneration protein
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    768206 (PRCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rod_cone_degen
Motif
Other DBs
NCBI-GeneID: 768206
NCBI-ProteinID: NP_001071088
OMIM: 610598
HGNC: 32528
Ensembl: ENSG00000214140
Vega: OTTHUMG00000132200
Pharos: Q00LT1(Tdark)
UniProt: Q00LT1
Position
17q25.1
AA seq 54 aa AA seqDB search
MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSLDADPQSSGREKEPLK
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccacccttttcctgctcagcaccctggccatgctctggcgccgccgatttgcc
aaccgagtccaaccagagcccagcgacgtggatggggcagctaggggcagcagcttggat
gcggaccctcagtcctcaggcagggagaaagaacctctgaagtaa

DBGET integrated database retrieval system