KEGG   Homo sapiens (human): 770
Entry
770               CDS       T01001                                 
Symbol
CA11, CA-RP, CA-RP_II, CA-XI, CARP-2, CARPX1
Name
(RefSeq) carbonic anhydrase 11
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 770
NCBI-ProteinID: NP_001208
OMIM: 604644
HGNC: 1370
Ensembl: ENSG00000063180
Vega: OTTHUMG00000183320
Pharos: O75493(Tbio)
UniProt: O75493
Position
19:complement(48637946..48646187)
AA seq 328 aa
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNG
LAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGVPHGR
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggggctgcagctcgtctgagcgcccctcgagcgctggtactctgggctgcactgggg
gcagcagctcacatcggaccagcacctgaccccgaggactggtggagctacaaggataat
ctccagggaaacttcgtgccagggcctcctttctggggcctggtgaatgcagcgtggagt
ctgtgtgctgtggggaagcggcagagccccgtggatgtggagctgaagagggttctttat
gacccctttctgcccccattaaggctcagcactggaggagagaagctccggggaaccttg
tacaacaccggccgacatgtctccttcctgcctgcaccccgacctgtggtcaatgtgtct
ggaggtcccctcctttacagccaccgactcagtgaactgcggctgctgtttggagctcgc
gacggagccggctcggaacatcagatcaaccaccagggcttctctgctgaggtgcagctc
attcacttcaaccaggaactctacgggaatttcagcgctgcctcccgcggccccaatggc
ctggccattctcagcctctttgtcaacgttgccagtacctctaacccattcctcagtcgc
ctccttaaccgcgacaccatcactcgcatctcctacaagaatgatgcctactttcttcaa
gacctgagcctggagctcctgttccctgaatccttcggcttcatcacctatcagggctct
ctcagcaccccgccctgctccgagactgtcacctggatcctcattgaccgggccctcaat
atcacctcccttcagatgcactccctgagactcctgagccagaatcctccatctcagatc
ttccagagcctcagcggtaacagccggcccctgcagcccttggcccacagggcactgagg
ggcaacagggacccccggcaccccgagaggcgctgccgaggccccaactaccgcctgcat
gtggatggtgtcccccatggtcgctga

DBGET integrated database retrieval system