KEGG   Homo sapiens (human): 7703Help
Entry
7703              CDS       T01001                                 

Gene name
PCGF2, MEL-18, RNF110, TPFS, ZNF144
Definition
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7703 (PCGF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7703 (PCGF2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     7703 (PCGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 zf-Nse zf-ANAPC11 Rad60-SLD zf-RING_10
Motif
Other DBs
NCBI-GeneID: 7703
NCBI-ProteinID: NP_009075
OMIM: 600346
HGNC: 12929
Ensembl: ENSG00000277258
Vega: OTTHUMG00000188501
Pharos: P35227(Tbio)
UniProt: P35227 A0A024R1V6
Position
17q12
AA seq 344 aa AA seqDB search
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggactacacggatcaaaatcacagagctgaacccccacctcatgtgtgccctc
tgcggggggtacttcatcgacgccaccactatcgtggagtgcctgcattccttctgcaaa
acctgcatcgtgcgctacctggagaccaacaaatactgccccatgtgtgacgtgcaggtc
cataaaacccggccgctgctgagcatcaggtctgacaaaacacttcaagacattgtctac
aaattggtccctgggctttttaaagatgagatgaaacggcggcgggatttctatgcagcg
taccccctgacggaggtccccaacggctccaatgaggaccgcggcgaggtcttggagcag
gagaagggggctctgagtgatgatgagattgtcagcctctccatcgaattctacgaaggt
gccagggaccgggacgagaagaagggccccctggagaatggggatggggacaaagagaaa
acaggggtgcgcttcctgcgatgcccagcagccatgaccgtcatgcatcttgccaagttt
ctccgcaacaagatggatgtgcccagcaagtacaaggtggaggttctgtacgaggacgag
ccactgaaggaatactacaccctcatggacatcgcctacatctacccctggcggcggaac
gggcctctccccctcaagtaccgtgtccagccagcctgcaagcggctcaccctagccacg
gtgcccaccccctccgagggcaccaacaccagcggggcgtccgagtgtgagtcagtcagc
gacaaggctcccagccctgccaccctgccagccacctcctcctccctgcccagcccagcc
accccatcccatggctctcccagttcccatgggcctccagccacccaccctacctccccc
actcccccttcgacagccagtggggccaccacagctgccaacgggggtagcttgaactgc
ctgcagacaccatcctccaccagcagggggcgcaagatgactgtcaacggcgctcccgtg
ccccccttaacttga

DBGET integrated database retrieval system