KEGG   Homo sapiens (human): 7706Help
Entry
7706              CDS       T01001                                 

Gene name
TRIM25, EFP, RNF147, Z147, ZNF147
Definition
(RefSeq) tripartite motif containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05164  Influenza A
Network
nt06133  RIG-I signaling (viruses)
nt06170  Influenza A virus (IAV)
  Element
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7706 (TRIM25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    7706 (TRIM25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    7706 (TRIM25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7706 (TRIM25)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7706 (TRIM25)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    7706 (TRIM25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PRY zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-RING_5 Prok-RING_4 zf-B_box zf-UBP_var Pox_Rif C5HCH Exonuc_VII_L HscB_4_cys IDEAL Fibin
Motif
Other DBs
NCBI-GeneID: 7706
NCBI-ProteinID: NP_005073
OMIM: 600453
HGNC: 12932
Ensembl: ENSG00000121060
Vega: OTTHUMG00000178124
Pharos: Q14258(Tbio)
UniProt: Q14258
Structure
PDB: 

Position
17q22
AA seq 630 aa AA seqDB search
MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQAR
PQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCL
VCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICL
VEHKTCSPASLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQ
LQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT
KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQCIGRLQEPTP
SSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVAS
VAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPES
RLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM
YKFRVDFTEALYPAFWVFSAGATLSICSPK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgtgccccctggccgaggagctgtcgtgctccatctgcctggagcccttc
aaggagccggtcaccactccgtgcggccacaacttctgcgggtcgtgcctgaatgagacg
tgggcagtccagggctcgccatacctgtgcccgcagtgccgcgccgtctaccaggcgcga
ccgcagctgcacaagaacacggtgctgtgcaacgtggtggagcagttcctgcaggccgac
ctggcccgggagccacccgccgacgtctggacgccgcccgcccgcgcctctgcacccagc
ccgaatgcccaggtggcctgcgaccactgcctgaaggaggccgccgtgaagacgtgcttg
gtgtgcatggcctccttctgtcaggagcacctgcagccgcacttcgacagccccgccttc
caggaccacccgctgcagccgcccgttcgcgacctgttgcgccgcaaatgttcccagcac
aatcggctgcgggaatttttctgccccgagcacagcgagtgcatctgccacatctgcctg
gtggagcataagacctgctctcccgcgtccctgagccaggccagcgccgacctggaggcc
accctgaggcacaaactaactgtcatgtacagtcagatcaacggggcgtcgagagcactg
gatgatgtgagaaacaggcagcaggatgtgcggatgactgcaaacagaaaggtggagcag
ctacaacaagaatacacggaaatgaaggctctcttggacgcctcagagaccacctcgaca
aggaagataaaggaagaggagaagagggtcaacagcaagtttgacaccatttatcagatt
ctcctcaagaagaagagtgagatccagaccttgaaggaggagattgaacagagcctgacc
aagagggatgagttcgagtttctggagaaagcatcaaaactgcgaggaatctcaacaaag
ccagtctacatccccgaggtggaactgaaccacaagctgataaaaggcatccaccagagc
accatagacctcaaaaacgagctgaagcagtgcatcgggcggctccaggagcccaccccc
agttcaggtgaccctggagagcatgacccagcgtccacacacaaatccacacgccctgtg
aagaaggtctccaaagaggaaaagaaatccaagaaacctccccctgtccctgccttaccc
agcaagcttcccacgtttggagccccggaacagttagtggatttaaaacaagctggcttg
gaggctgcagccaaagccaccagctcacatccgaactcaacatctctcaaggccaaggtg
ctggagaccttcctggccaagtccagacctgagctcctggagtattacattaaagtcatc
ctggactacaacaccgcccacaacaaagtggctctgtcagagtgctatacagtagcttct
gtggctgagatgcctcagaactaccggccgcatccccagaggttcacatactgctctcag
gtgctgggcctgcactgctacaagaaggggatccactactgggaggtggagctgcagaag
aacaacttctgtggggtaggcatctgctacggaagcatgaaccggcagggcccagaaagc
aggctcggccgcaacagcgcctcctggtgcgtggagtggttcaacaccaagatctctgcc
tggcacaataacgtggagaaaaccctgccctccaccaaggccacgcgggtgggcgtgctt
ctcaactgtgaccacggctttgtcatcttcttcgctgttgccgacaaggtccacctgatg
tataagttcagggtggactttactgaggctttgtacccggctttctgggtattttctgct
ggtgccacactctccatctgctcccccaagtag

DBGET integrated database retrieval system