KEGG   Homo sapiens (human): 771Help
Entry
771               CDS       T01001                                 

Gene name
CA12, CA-XII, CAXII, HsT18816, T18816
Definition
(RefSeq) carbonic anhydrase 12
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
Disease
H01302  Hyperchlorhidrosis isolated (HCHLH)
Drug target
Acetazolamide (DG01134): D00218 D01196
Clofenamide: D01822
Diclofenamide: D00518
Dorzolamide (DG01135): D00653 D07871
Ethoxzolamide: D02441
Methazolamide: D00655
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    771 (CA12)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     771 (CA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase DUF4191 DUF3149
Motif
Other DBs
NCBI-GeneID: 771
NCBI-ProteinID: NP_001209
OMIM: 603263
HGNC: 1371
Ensembl: ENSG00000074410
Vega: OTTHUMG00000132881
Pharos: O43570(Tclin)
UniProt: O43570
Structure
PDB: 

Position
15q22.2
AA seq 354 aa AA seqDB search
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgccccggcgcagcctgcacgcggcggccgtgctcctgctggtgatcttaaaggaacag
ccttccagcccggccccagtgaacggttccaagtggacttattttggtcctgatggggag
aatagctggtccaagaagtacccgtcgtgtgggggcctgctgcagtcccccatagacctg
cacagtgacatcctccagtatgacgccagcctcacgcccctcgagttccaaggctacaat
ctgtctgccaacaagcagtttctcctgaccaacaatggccattcagtgaagctgaacctg
ccctcggacatgcacatccagggcctccagtctcgctacagtgccacgcagctgcacctg
cactgggggaacccgaatgacccgcacggctctgagcacaccgtcagcggacagcacttc
gccgccgagctgcacattgtccattataactcagacctttatcctgacgccagcactgcc
agcaacaagtcagaaggcctcgctgtcctggctgttctcattgagatgggctccttcaat
ccgtcctatgacaagatcttcagtcaccttcaacatgtaaagtacaaaggccaggaagca
ttcgtcccgggattcaacattgaagagctgcttccggagaggaccgctgaatattaccgc
taccgggggtccctgaccacacccccttgcaaccccactgtgctctggacagttttccga
aaccccgtgcaaatttcccaggagcagctgctggctttggagacagccctgtactgcaca
cacatggacgacccttcccccagagaaatgatcaacaacttccggcaggtccagaagttc
gatgagaggctggtatacacctccttctcccaagtgcaagtctgtactgcggcaggactg
agtctgggcatcatcctctcactggccctggctggcattcttggcatctgtattgtggtg
gtggtgtccatttggcttttcagaaggaagagtatcaaaaaaggtgataacaagggagtc
atttacaagccagccaccaagatggagactgaggcccacgcttga

DBGET integrated database retrieval system