KEGG   Homo sapiens (human): 7716Help
Entry
7716              CDS       T01001                                 

Gene name
VEZF1, DB1, ZNF161
Definition
(RefSeq) vascular endothelial zinc finger 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz Spt20 zf-Di19 zf-BED zf-met EOS1 WASH-7_C
Motif
Other DBs
NCBI-GeneID: 7716
NCBI-ProteinID: NP_009077
OMIM: 606747
HGNC: 12949
Ensembl: ENSG00000136451
Vega: OTTHUMG00000178777
Pharos: Q14119(Tbio)
UniProt: Q14119
Position
17q22
AA seq 521 aa AA seqDB search
MEANWTAFLFQAHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQGAPETLK
DAIGIKKEKPKTSFVCTYCSKAFRDSYHLRRHESCHTGIKLVSRPKKTPTTVVPLISTIA
GDSSRTSLVSTIAGILSTVTTSSSGTNPSSSASTTAMPVTQSVKKPSKPVKKNHACEMCG
KAFRDVYHLNRHKLSHSDEKPFECPICNQRFKRKDRMTYHVRSHEGGITKPYTCSVCGKG
FSRPDHLSCHVKHVHSTERPFKCQTCTAAFATKDRLRTHMVRHEGKVSCNICGKLLSAAY
ITSHLKTHGQSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQQQQQHVTSWP
GKQVETLRLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFSITSSVSSGTMSNPVTVAA
AMSMRSPVNVSSAVNITSPMNIGHPVTITSPLSMTSPLTLTTPVNLPTPVTAPVNIAHPV
TITSPMNLPTPMTLAAPLNIAMRPVESMPFLPQALPTSPPW
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaactggaccgcgttcctgttccaggcccatgaagcttcccatcaccaacag
caggcagcacagaacagcttgctgcccctcctgagctctgccgtggagccccctgatcag
aaaccattgcttccaataccaataactcagaaacctcagggtgcaccagaaacattaaag
gatgccattgggattaaaaaagaaaaacccaaaacttcatttgtgtgcacttactgcagt
aaagctttcagggacagctatcacctgaggcgccacgaatcctgccacacagggatcaag
ttggtgtcccggccaaagaaaacccccaccacggtggttccccttatctctaccatcgct
ggggacagcagccgaacttcgttggtctcgaccattgcaggcatcttgtcaacagtcact
acatcttcctcgggcaccaaccccagtagcagtgccagcaccacagctatgccagtgacc
cagtctgtcaagaaacccagtaagcctgtcaagaagaaccatgcttgtgagatgtgtggg
aaggccttccgagatgtgtaccatctcaatcgacacaagctctcccattcagatgagaaa
ccctttgagtgtcctatttgtaatcagcgcttcaagaggaaggaccggatgacttaccat
gtgaggtctcatgaaggaggcatcaccaaaccctatacttgcagtgtttgtgggaaaggc
ttctcaaggcctgaccacttaagctgtcatgtaaaacatgtccattcaacagaaagaccc
ttcaaatgccaaacgtgcactgctgcctttgccaccaaagacagactgcggacacacatg
gtgcgccatgaaggcaaggtatcatgtaacatctgtgggaagctcctgagtgcagcatac
atcaccagccacttaaagactcatgggcagagccaaagtatcaactgtaatacatgtaaa
caaggcatcagtaaaacatgcatgagtgaagagaccagtaaccaaaagcagcagcagcag
cagcagcagcagcagcagcagcagcaacaacaacaacaacaacatgtgacaagctggcca
gggaagcaagtagaaacactgagactgtgggaagaagctgttaaagcaaggaagaaagaa
gctgctaacctgtgccaaacctccacggctgctacgacacctgtgactctcactactcca
ttcagtataacatcctctgtgtcgtctgggactatgtcaaacccagtcacagtggcagct
gcaatgagcatgagaagtccagtaaatgtttcaagtgcagttaacataaccagcccaatg
aacatagggcatcctgtaactataaccagtccattatccatgacctctcctttaacactc
actaccccagtcaacctccccacccccgtcactgccccagtgaatatagcacaccctgtc
accatcacatctccaatgaatctacccacacctatgacattagccgcccctctcaatata
gcaatgagacctgtagagagcatgcctttcttgccccaagctttgcctacatcaccgcct
tggtaa

DBGET integrated database retrieval system