KEGG   Homo sapiens (human): 7730Help
Entry
7730              CDS       T01001                                 

Gene name
ZNF177, PIGX
Definition
(RefSeq) zinc finger protein 177
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7730 (ZNF177)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7730 (ZNF177)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7730 (ZNF177)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf-met Zn-ribbon_8 zf-LYAR zinc_ribbon_15 DUF3268
Motif
Other DBs
NCBI-GeneID: 7730
NCBI-ProteinID: NP_001166122
OMIM: 601276
HGNC: 12966
Ensembl: ENSG00000188629
Vega: OTTHUMG00000179943
Pharos: Q13360(Tdark)
UniProt: Q13360 A0A0A6YYI6
Position
19p13.2
AA seq 481 aa AA seqDB search
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTAENQPGEH
SLECNHCGKFRKNTRFICTRYCKGEKCYKYIKYSKVFNHPSTLRSHVSIHIGEKTLEFTD
CRKAFNQESSLRKHLRTPTGQKFQEYEQCDMSFSLHSSCSVREQIPTGEKGDECSDYGKI
SPLSVHTKTGSVEEGLECNEHEKTFTDPLSLQNCVRTHSGEMPYECSDCGKAFIFQSSLK
KHMRSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHVR
THTGEKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSYLIVHKRTHTG
EKTYECKECGKAFRNSSCLRVHVRTHTGEKPYKCIQCEKAFSTSTNLIMHKRIHNGQKLH
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagggtggctgacaacctggtcacagaactcagtaaccttccaggaagtggca
gtggacttttcccaggaggagtgggcattgctggaccctgctcaaaaaaatctatacaaa
gatgtgatgctggagaactttaggaacctggcctcagtagggtatcagctctgcagacac
agtctgatctccaaggtggatcaagaacagctgaagacagatgaaagaggaattttacaa
ggtgactgtgcagactgggaaactcaacttaaaccaaaagatacaattgctatgcagaac
attcctgggggaaaaacatccaatggcataaacacggcagaaaatcaacctggtgagcac
tccctggagtgtaaccattgtgggaaattcagaaagaacactcgctttatttgtacaaga
tattgcaagggagagaaatgctataaatatataaagtatagcaaagtcttcaaccatccc
tcaactcttaggagtcatgtgagcattcacattggagagaaaactcttgaatttactgat
tgtagaaaagctttcaatcaagagtcatccctcaggaaacacttaagaactcccacagga
cagaagtttcaggagtatgagcaatgtgatatgtccttcagcctacactcttcctgctca
gtacgtgagcaaatacctactggagagaaaggtgatgaatgcagtgactatggcaaaata
tctccccttagtgtccacacaaaaactggtagtgtggaggagggtttggaatgtaatgaa
catgagaaaactttcactgaccctttgtcccttcagaactgtgtcagaactcactctgga
gagatgccctatgaatgcagtgactgtgggaaagccttcatttttcagtcttcccttaag
aaacacatgagatctcatactggagagaagccttatgagtgtgatcactgtggaaaatcc
tttagccagagctctcatctgaatgtgcacaaaagaactcacactggagagaaaccctat
gactgtaaggaatgtgggaaggctttcactgttccttcatcccttcagaaacatgtgaga
acccacactggagagaaaccctatgaatgcagtgactgtggaaaagccttcatcgatcag
tcatcccttaagaaacacacacgctctcacactggagagaagccttatgagtgtaaccag
tgtggaaagtccttcagcacaggctcttaccttattgtgcacaagagaactcacactggt
gagaaaacctatgagtgtaaagaatgtgggaaggcctttaggaattcctcttgcctgagg
gtacacgtgagaactcacactggagagaagccttataaatgtattcagtgtgaaaaagcc
tttagcacaagcactaaccttataatgcacaagcgaatccacaatggccagaaactccat
gaatga

DBGET integrated database retrieval system