KEGG   Homo sapiens (human): 7732Help
Entry
7732              CDS       T01001                                 

Gene name
RNF112, BFP, ZNF179
Definition
(RefSeq) ring finger protein 112
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GBP zf-C3HC4_4 zf-C3HC4 zf-C3HC4_3 zf-RING_5 zf-C3HC4_2 zf-RING_2 AAA_16 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 7732
NCBI-ProteinID: NP_009079
OMIM: 601237
HGNC: 12968
Ensembl: ENSG00000128482
Vega: OTTHUMG00000059601
Pharos: Q9ULX5(Tbio)
UniProt: Q9ULX5
Position
17p11.2
AA seq 631 aa AA seqDB search
MPRPALSVTSFCHRLGKRERKQSFMGNSGNSWSHTPFPKLELGLGPQPMAPRELPTCSIC
LERLRDPISLDCGHDFCIRCFSTHRLPGCEPPCCPECRKICKQKRGLRSLGEKMKLLPQR
PLPPALQETCPVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHS
GKSFLLNHLLQGLPGLESGEGGRPRGGEASLQGCRWGANGLARGIWMWSHPFLLGKEGKK
VAVFLVDTGDAMSPELSRETRIKLCALTTMLSSYQILSTSQELKDTDLDYLEMFVHVAEV
MGKHYGMVPIQHLDLLVRDSSHPNKAGQGHVGNIFQRLSGRYPKVQELLQGKRARCCLLP
APGRRRMNQGHASPGDTDDDFRHLLGAYVSDVLSAAPQHAKSRCQGYWNEGRAVARGDRR
LLTGQQLAQEIKNLSGWMGRTGPGFTSPDEMAAQLHDLRKVEAAKREFEEYVRQQDVATK
RIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKGRDQTLEALEAELQATAKAFMDSYT
MRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGV
GAGLAATVGCMEKEEDERLLEGDREPLLQEE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcccgccttgtcagtcacttccttttgtcatcggcttggcaaacgggagaga
aaacagagcttcatgggaaacagcggcaacagttggtcccatacacctttccccaagttg
gagctaggcctggggccccagcccatggcgccccgggagctccctacctgctccatctgc
ctggagaggttgcgcgaccccatctcgctggactgtggccacgacttctgcatacggtgc
ttcagcacacaccgtctcccgggctgtgagccgccctgctgtcctgagtgccggaagata
tgcaagcagaagaggggcctccggagcctgggcgagaagatgaagctcctgccgcagcgg
ccgctgccccctgcactgcaggagacgtgtcctgtgagggcggagccgctgctgctggtt
cgcatcaatgcctctgggggcctcatccttaggatgggggccatcaaccgctgcctgaag
caccctctggccagggacaccccagtctgcctcctcgctgtcctgggggagcagcactca
gggaagtccttcctcctcaaccatttgcttcagggcttgccgggcctggagtctggtgag
ggcggccggccaagaggaggagaggcatccctgcagggctgcaggtggggcgccaatggc
ctcgccaggggcatatggatgtggagccaccccttcttgctggggaaagaagggaagaag
gtggcggtgttcctggtggacacaggggatgccatgagccctgagctgagcagggaaaca
aggatcaagctctgtgctctcaccacgatgctgagctcctaccagatcctcagcacctcc
caggagctgaaggatacagacctggactatctggagatgtttgtccacgtggccgaggtg
atgggcaagcattatgggatggtgccaatccagcatctggacctcttagttcgtgactca
tcccaccccaacaaggcagggcaggggcatgtaggcaacatcttccagagattgtctggc
agataccccaaggtgcaggagctgctgcaagggaagcgagcccgttgctgcctcttgcct
gccccagggaggcggcggatgaaccaaggccatgcaagccctggtgacacagatgatgac
ttccgccaccttctgggggcctacgtctcagatgtgctgagtgcggccccccagcacgct
aagagccgctgccaggggtactggaacgaggggcgcgccgtggccaggggggacagacgc
ctactcacggggcagcagctagctcaggaaatcaagaacctctcaggatggatggggagg
acagggcccggtttcacctctccggatgagatggctgctcagctgcacgacctgaggaag
gtggaagctgccaagagggagttcgaggagtatgtgaggcagcaggacgtagccaccaag
cgcatattctctgcgctgcgggtcctgccagacaccatgcggaacctcctctccacccag
aaagatgccattctggcccgccatggtgtggccttactctgcaaggggagagatcagacc
ttggaggcactggaagctgagctgcaggccacggccaaggccttcatggactcctacacg
atgcgcttctgtggccacctagctgctgtggggggtgctgtgggggccgggctcatgggc
ctggcagggggcgtggtgggtgctggcatggcagcagctgcactggctgcagaggctggg
atggtggctgctggagctgccgtgggggccacaggggccgctgtggttgggggtggcgtg
ggtgctgggttggctgccacagtgggctgcatggagaaggaggaggatgagaggcttctg
gaaggggaccgagagccccttctccaggaagagtaa

DBGET integrated database retrieval system