KEGG   Homo sapiens (human): 7738Help
Entry
7738              CDS       T01001                                 

Gene name
ZNF184, kr-ZNF3
Definition
(RefSeq) zinc finger protein 184
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7738 (ZNF184)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7738 (ZNF184)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_11 zf_UBZ XPA_N zf-C2H2_jaz zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 7738
NCBI-ProteinID: NP_001305820
OMIM: 602277
HGNC: 12975
Ensembl: ENSG00000096654
Vega: OTTHUMG00000014478
Pharos: Q99676(Tdark)
UniProt: Q99676 A0A024RCM2
Position
6p22.1
AA seq 751 aa AA seqDB search
MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLEN
YTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEE
LSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVN
NEFGKSVNVSSNLVTQEPSPEETSTKRSIKQNSNPVKKEKSCKCNECGKAFSYCSALIRH
QRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIH
TGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEK
PFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC
NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECG
KAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFI
RSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIH
LTQHKRIHTGAKPYECAECGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQH
QRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRIH
SGEKPFGCNDCGKSFRYRSALNKHQRLHPGI
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggaagatctgtcctctccagactccacccttctccaagggggacataatctactctca
tcagccagttttcaggaagcggtgactttcaaggatgtgatagtggactttacccaggaa
gaatggaaacagctggaccctggccagagagatttgttcagggatgtgacattggaaaat
tatacacacctggtctctataggactccaagtttctaaacctgatgtgatttcccagtta
gagcaagggacagagccatggatcatggagccaagcattccagtaggtacctgtgcagac
tgggagacaagacttgaaaatagtgtgtcagccccagagcctgacatttctgaagaagag
ctatctccagaggtaatagtggaaaaacacaaaagagatgattcttggagttccaacttg
ctagaaagttgggaatatgaaggcagtttagagagacagcaggcaaaccaacagacactg
ccaaaggaaataaaggtaaccgaaaagacaatacccagttgggaaaaaggccctgtaaat
aatgaatttgggaaaagtgtcaatgtgagttcaaaccttgtaacacaagaaccatctcca
gaagagacctctactaaaagaagcatcaaacagaattcaaacccagttaaaaaagagaaa
tcttgtaagtgcaatgaatgtgggaaagcctttagttattgttcagctcttattcgccat
cagagaacacatactggagaaaaaccctacaaatgtaatgaatgtgaaaaagccttcagc
cggagtgaaaaccttataaaccatcaaagaattcatactggagataaaccatataaatgt
gatcagtgtggaaaaggcttcattgagggtccatctcttactcaacatcaaagaattcat
actggagaaaaaccatataaatgtgatgaatgtgggaaagcctttagtcagaggacccat
cttgttcagcatcagagaattcatactggcgagaagccatacacttgtaatgagtgtgga
aaagcctttagccagagaggccactttatggaacatcagaaaattcatacgggagaaaaa
ccttttaaatgtgatgaatgtgataaaaccttcaccaggagcacacaccttactcaacat
caaaaaattcatactggagaaaaaacctataaatgtaatgaatgtggaaaggccttcaac
gggccctcaacttttatccgtcatcatatgattcatactggtgaaaaaccgtacgaatgc
aatgaatgtgggaaagccttcagccagcactcaaacctcactcagcatcaaaaaactcat
actggggagaaaccctatgattgtgcagaatgtggaaaatcttttagttactggtcatcc
cttgctcaacacctgaaaattcatactggagaaaaaccttacaaatgcaatgaatgtgga
aaggccttcagttactgctcatcccttactcaacatcggagaattcacacgagagaaaag
ccctttgaatgcagtgaatgtggaaaggctttcagttatctctcaaaccttaatcagcat
cagaaaactcatactcaagagaaagcttatgaatgtaaagaatgtgggaaagcttttatt
cggagttcatctcttgctaagcatgaaagaattcatactggagagaaaccctatcagtgt
catgaatgtgggaaaaccttcagttatggttcatcccttattcagcataggaagatccat
actggagaacgaccttacaagtgtaatgagtgtgggagagcattcaaccagaacatacac
cttacacagcataagagaattcatacaggagccaagccttatgagtgtgctgagtgtggt
aaagcctttcgacattgttcatctcttgctcaacatcaaaaaactcacacagaagaaaaa
ccctaccagtgtaataaatgtgaaaagacctttagccagagctcccatctaactcagcat
caacgaattcacactggggagaagccctataagtgcaatgaatgtgacaaagcctttagc
cggagcactcatctgactgaacatcagaatactcatactggagagaaaccttataactgt
aatgaatgcagaaagacttttagccagagcacatatctcattcagcaccagagaattcat
tcaggagagaagccttttggatgtaatgattgtggaaaatccttcagatatcgctctgct
ctcaacaaacatcagagactgcatcctggcatatga

DBGET integrated database retrieval system