KEGG   Homo sapiens (human): 7746Help
Entry
7746              CDS       T01001                                 

Gene name
ZSCAN9, PRD51, ZNF193
Definition
(RefSeq) zinc finger and SCAN domain containing 9
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7746 (ZSCAN9)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7746 (ZSCAN9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCAN zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 XPA_N FYVE zf-C2H2_11 zinc_ribbon_15 C1_4
Motif
Other DBs
NCBI-GeneID: 7746
NCBI-ProteinID: NP_001186409
OMIM: 602246
HGNC: 12984
Ensembl: ENSG00000137185
Vega: OTTHUMG00000014515
Pharos: O15535(Tdark)
UniProt: O15535 A0A024RCK9
Position
6p22.1
AA seq 394 aa AA seqDB search
MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCY
QETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESG
EEAVILLEDLERELDEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSA
QKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDR
IERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNH
RGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSH
TGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaactcaaaggaggttttatccctgggtgttcaagttcccgaggcatgggaa
gaacttctgacaatgaaagtggaagcaaaaagtcaccttcaatggcaggaatccagactg
aaacgcagtaatccactggcaagggaaatcttccgaaggcactttcgacagctgtgctac
caagagacccctggaccaagggaggctcttactcgactccaggaactttgctaccagtgg
ttgaggccacatgtgagcacaaaggagcagattttggatctgctggtgctggagcagttt
ctatccattctgcccaaggagctccagggctgggtgagggaacactgtccagagagtgga
gaagaggctgtgattttgctggaggatctggagagagagctcgatgaaccacaacatgag
atggtggcccacagacacagacaagaagtcctctgtaaagagatggtgcctctagcagag
cagacaccactgacccttcagtcccagcctaaggagccacagctcacatgtgactctgct
cagaagtgccattctattggagagacagatgaagtaaccaagactgaggacagagagttg
gtgctaaggaaagactgtcctaagatagtggaaccacatgggaaaatgtttaatgagcag
acctgggaggtatcacagcaggatccctcacatggagaagttggtgaacataaggatagg
atagagaggcagtggggaaacctcttaggagaggggcaacacaaatgtgatgaatgtggg
aagagctttactcagagctcaggtctcattcgacatcaaagaattcatactggagaaaga
ccttatgaatgtaatgaatgtgggaaagccttcagtcgaagttctggtctttttaatcac
cgaggaatccacaatatacagaaacggtaccactgcaaggagtgtgggaaggtcttcagt
cagagtgcgggtcttatccagcatcagagaatccacaaaggagaaaagccgtatcagtgc
agccagtgcagtaagagctacagtcggcgttcatttctcattgaacatcagagaagccac
acaggggagcgacctcaccagtgcattgaatgtgggaaaagctttaatcgacactgcaac
ctcattcgccatcagaagatccacacagtggctgagctggtctag

DBGET integrated database retrieval system