KEGG   Homo sapiens (human): 7757Help
Entry
7757              CDS       T01001                                 

Gene name
ZNF208, PMIDP, ZNF95
Definition
(RefSeq) zinc finger protein 208
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7757 (ZNF208)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7757 (ZNF208)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 XPA_N zf-C2H2_jaz KRAB zf-C2H2_8 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 7757
NCBI-ProteinID: NP_009084
OMIM: 603977
HGNC: 12999
Ensembl: ENSG00000160321
Vega: OTTHUMG00000182913
Pharos: O43345(Tdark)
UniProt: O43345
Position
19p12
AA seq 1280 aa AA seqDB search
MGSLTFRDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAFKPDLIIFLEEGK
ESWNMKRHEMVEESPVICSHFAQDLWPEQGIEDSFQKVILRRYEKCGHENLHLKIGYTNV
DECKVHKEGYNKLNQSLTTTQSKVFQRGKYANVFHKCSNSNRHKIRHTGKKHLQCKEYVR
SFCMLSHLSQHKRIYTRENSYKCEEGGKAFNWSSTLTYYKSAHTGEKPYRCKECGKAFSK
FSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHTGEKPNKCEECGKAFSKVSTL
TTHKAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPYKCKECGKAFSKFSILTKHK
VIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVIHT
GEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCEECGKGFSMFSILTKHKVIHNGEKP
YKCEECDKATHAGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSIL
TKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKAFNQSAILIKHK
RIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTHKAIHA
GEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKP
YKCEECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE
ECGKAFNRSAILIKHKRIHTDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGK
AFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSM
FSILTKHEVIHTGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTL
SYHKKIHTEEKPYKYEECGKGFSTFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHK
KIHTGETPYKCEECDKAFSWPSSLTEHKATHAGEKPYKCEECGKAFSWPSRLTEHKATHA
GEEPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTGEKP
YKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKGFVMFSILAKHKVIHTGEKLYKCE
ECGKAYKWPSTLRYHKKIHTGEKPYKCEECGKAFSTFSILTKHKVIHTGEKPYKCEECGK
AFSWLSVFSKHKKIHTGEKL
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgggatcattgacatttagggatgtggccatagaattctctctggaggagtggcaatgc
ctggacactgcacagcagaatttatatagaaatgtgatgttagagaactacagaaacctg
gtcttcctgggtattgctgcctttaagccagacctgatcatttttctggaggaaggaaaa
gagtcctggaatatgaagagacatgagatggtggaagaatccccagttatatgttctcat
tttgctcaagatctttggccagagcagggcatagaagattctttccaaaaagtgatattg
agaaggtatgaaaaatgtggacatgagaatttacacttaaaaattggttataccaatgtg
gatgagtgtaaggtgcacaaagaaggttataataaacttaaccagagtttgacaactaca
cagagcaaagtatttcaacgtggcaaatatgcaaatgtctttcataaatgttcaaattca
aacagacataagataaggcatactggaaagaaacatttgcaatgtaaagaatacgtcaga
tcattttgcatgctttcacacctatctcaacataaaagaatttatactagagagaattcc
tacaaatgtgaagaaggtggcaaagcttttaactggtcctcaacccttacttattataag
agtgctcatactggagagaaaccctacagatgtaaagaatgtggcaaagcctttagtaag
ttctcaatccttactaaacataaggtaattcatactggagagaaatcctacaaatgtgaa
gaatgtggcaaggcttttaaccaatctgcaatccttactaaacataagataattcatact
ggagagaaacccaacaaatgtgaagaatgtggcaaagcctttagtaaggtctcgactctt
actacacataaggcaattcatgctggagagaagccctacaaatgtaaagaatgtggcaaa
gccttcagtaaggtctcaacccttattacacataaggcaattcatgctggagagaagccc
tacaaatgtaaagaatgtggcaaagcctttagtaagttctcaatccttactaaacataag
gtaattcatactggagagaaaccctacaaatgtgaagaatgcggcaaagcctataagtgg
ccctcaacccttagttatcataagaaaattcatactggagagaaaccctacaaatgtgaa
gaatgtggcaaaggttttagtatgttctcaatccttactaaacatgaggtcattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagctttcaactggtcctcaaacctt
atggaacataagaaaattcacactggagagacaccctacaaatgtgaagaatgtggcaaa
ggctttagtatgttctcaatccttactaaacataaggtaattcataatggagagaaaccc
tacaaatgtgaagaatgtgataaggcaactcatgctggagagaaaccctacaaatgtgaa
gaatgtggcaaagctttcaactggtcctcaaaccttatggaacataagagaattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaaagcttcagtacattctcaatcctt
actaaacataaggtaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gcctataagtggtcctcaacccttagttatcataagaaaattcatactgtagagaaaccc
tacaaatgtgaagaatgtggcaaagcttttaaccaatctgcaattcttattaaacataag
agaattcatactggtgagaaaccctacaaatgtgaagaatgtggcaaaacctttagtaag
gtctcaacccttactacacataaggcaattcatgctggagagaagccctacaaatgtaaa
gaatgtggcaaaacctttattaaggtctcaacccttactacacataaggcaattcatgct
ggagagaagccctacaaatgtaaagaatgtggcaaagcctttagtaagttctcaatcctt
actaaacataaggtaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gctttcaactggtcctcaaaccttatggaacataagagaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaaagctttagtacattctcagtccttactaaacataag
gtaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcctataagtgg
tcctcaacccttagttatcataagaaaattcatactgtagagaaaccctacaaatgtgaa
gaatgtggcaaagcttttaaccgatctgcaatccttattaaacataagagaattcatact
gatgagaaaccctacaaatgtgaagaatgtggcaaaacctttagtaaggtctcaaccctt
actacacataaggcaattcatgctggagaaaagccctacaaatgtaaagaatgtggcaaa
gcctttagtaagttctcaatccttactaaacataaggtaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagcctataaatggccctcaacccttagttatcataag
aaaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaaggttttagtatg
ttctccatccttactaaacatgaggtaattcatactggagagaaaccctacaaatgtgaa
gaatgtggcaaagccttcagctggttgtcagtctttagtaaacataagaaaactcatgct
ggagagaaattctacaaatgtgaagcatgtggcaaagcctataagtcatcctcaaccctt
agttatcataagaaaattcatactgaagagaaaccttacaaatatgaagaatgtggcaaa
ggctttagtacattctcaatccttactaaacataaggtaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagctttcaactggtcatcaaaccttatggaacataag
aaaattcacactggagagacaccctacaaatgtgaagaatgtgacaaagccttcagctgg
ccctcaagccttactgaacataaggcaactcatgctggagaaaaaccctacaaatgtgaa
gaatgtggcaaagccttcagctggccctcaagacttactgaacataaggcaactcatgct
ggagaggaaccctacaaatgtgaagaatgtggcaaagctttcaactggtcctcaaacctt
atggaacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
agctttagtacgttctcaatccttactaaacataaggtaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagcctataagtggtcctcaacccttagttatcataag
aaaattcatactgtagagaaaccctacaaatgtgaagaatgtggcaaaggctttgttatg
ttctcaatccttgcaaaacataaggtaattcatactggagagaaactctacaaatgtgaa
gaatgtggcaaagcctataagtggccctcaacccttagatatcacaagaaaattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagcctttagtacgttctcaatcctc
actaaacataaggtaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gccttcagctggttatcagtcttcagtaaacataagaaaattcatactggagagaaactc
tag

DBGET integrated database retrieval system