KEGG   Homo sapiens (human): 7762
Entry
7762              CDS       T01001                                 
Symbol
ZNF215, BAZ-2, BAZ2, ZKSCAN11, ZSCAN43
Name
(RefSeq) zinc finger protein 215
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7762 (ZNF215)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    7762 (ZNF215)
SSDB
Motif
Pfam: SCAN zf-C2H2 zf-H2C2_2 KRAB zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 C1_4 zf-C2H2_8 zf-C2H2_11
Other DBs
NCBI-GeneID: 7762
NCBI-ProteinID: NP_037382
OMIM: 605016
HGNC: 13007
Ensembl: ENSG00000149054
UniProt: Q9UL58
Position
11:6926426..6994423
AA seq 517 aa
MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVS
GPHEALSQLWELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMV
TLIEDVIEMLEDEDMPCKDSALQMGSIKEKMKAGSRTGKPQEPVTFKDVVVEFSKEEWGQ
LDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRKTIFDMK
SISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED
FECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGKQHSEYEYGND
LSLSTDIRHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRT
NLTKHQKLHAEAKACTSNKCGKAFSKSEDSNNPTLHFGNNFYQCVNCGKSFNRSSSLIRH
QMIHTGEKPFKCKECSKAFNRSSNLVKHQKLHTRDKS
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcagcctctgagcaagttgatggctatctcaaaacctcgaaacctgtctctacgtgaa
caaagagaggttctgagagcagatatgtcttggcagcaggaaaccaaccccgtcgtggag
acacatgactctgaggcatctcgtcaaaagttcagacatttccagtatttgaaagtgtct
gggccccatgaagccctgagccaactctgggagctctgtcttcaatggctgagaccagag
attcatacaaagaagcagattatagaactgttggtgctggaacaattcctggcaatcctg
cctgaagaagtcaggacttgggtgaatttacaacatccaaacaacagtaaagatatggtg
accctcatagaagatgtgattgaaatgcttgaagatgaagatatgccctgcaaggactct
gccctgcagatggggagcatcaaggagaaaatgaaagctggctcacgaacaggcaaacca
caggaaccagtgacattcaaagatgtggttgtggaattcagcaaggaagagtgggggcaa
ctggactctgctgtaaagaacctgtacaggaatgtgatgctggaaaactttaggaacctg
aattcattgcgtaaagcacatctactttccaaaccatttgagagccttaagttggagagt
aagaaaaaaagatggataatggagaaagaaataccaaggaagactatttttgacatgaag
agtatttctggagaagaatcatcccatggagtgattatgacaaggcttaccgaaagtgga
cacccttcttcagatgcctggaaaggtgagaattggttatataggaaccagaaaaaatgg
gacataaatttgccacaagaggctttcattcctgagacaatttacactgaggaggaagat
tttgaatgtagtgaaaataagaaaagctttgatattaattcagttagctcaatttgtgct
atacaagtgggaattccttcaagaaaggggtctccaaaatgtgataagtttaaaacttac
ttcaaatttaatttagactcagtaggtaagcaacattcagaatatgaatatgggaatgac
ttgagtttgagtacagatattcgacaccaaaaaagtcatactacaatgaattcctatgaa
tgttatcaatgtgggaaagccttctgccgaagttcatcccttattcgacatcagatcatt
cacacaggagagaaaccctataaatgcagtgaatgtgggagattcttcaaccgacgtaca
aaccttactaagcatcaaaaacttcatgctgaagcaaaggcctgcacaagcaataaatgt
ggaaaggccttcagtaaaagtgaagacagtaataatccaacactccattttggaaacaat
ttctatcaatgtgttaactgtggaaaatccttcaaccggagctcctctcttattcgacac
caaatgattcacacgggagagaaaccattcaaatgtaaggaatgtagtaaagccttcaac
aggagttcaaaccttgttaaacatcaaaaactgcatactcgagataagtcctga

DBGET integrated database retrieval system