KEGG   Homo sapiens (human): 7767Help
Entry
7767              CDS       T01001                                 

Gene name
ZNF224, BMZF-2, BMZF2, KOX22, ZNF233, ZNF255, ZNF27
Definition
(RefSeq) zinc finger protein 224
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7767 (ZNF224)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7767 (ZNF224)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 BolA zf_UBZ XPA_N zf-met DUF3268 zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 7767
NCBI-ProteinID: NP_001308574
OMIM: 194555
HGNC: 13017
Ensembl: ENSG00000267680
Vega: OTTHUMG00000182313
Pharos: Q9NZL3(Tbio)
UniProt: Q9NZL3
Structure
PDB: 

Position
19q13.31
AA seq 707 aa AA seqDB search
MTTFKEAMTFKDVAVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQAFHRDTFHFL
REEKIWMMKTAIQREGNSGDKIQTEMETVSEAGTHQEWSFQQIWEKIASDLTRSQDLMIN
SSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDE
CGKNFCYISALRIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTGEKPFKCVECGKG
FSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCGR
SRLNRHSMVHTAEKPFRCDTCDKSFRQRSALNSHRMIHTGEKPYKCEECGKGFICRRDLY
THHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSG
EKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPY
NCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
CGKGFSWSSTRLTHQRRHSRETPLKCEQHGKNIVQNSFSKVQEKVHSVEKPYKCEDCGKG
YNRRLNLDMHQRVHMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKP
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgttcaaggaggcaatgaccttcaaggacgtggctgtggtcttcactgaggaa
gagctggggctgctggaccttgctcagaggaagctgtatcgagatgtgatgctggagaac
ttcaggaacctgctctcagtgggacatcaagcattccacagggatactttccacttccta
agggaagaaaagatttggatgatgaagacagcaatccaaagggaagggaattcaggagac
aagatccaaactgagatggagactgtttcagaagcaggaacacatcaagagtggtccttc
cagcaaatctgggaaaaaattgcaagtgatttaaccaggtctcaagacttgatgataaat
agctctcagttctccaaagaaggtgatttcccctgccagactgaggcaggactatctgta
attcacacaagacagaaatcttcccagggcaatggatataaaccatccttcagtgatgtc
tcccactttgattttcatcaacaattacactcaggagagaaatctcatacgtgtgatgag
tgtggaaagaacttttgttacatctcagcccttcgtattcatcagagagtccacatggga
gagaaatgctataagtgtgacgtgtgtggtaaggaattcagtcagagttcacatctgcaa
actcatcagagagtccacactggagagaaaccgttcaaatgtgtggaatgtgggaaaggc
ttcagtcgtagatcagcacttaatgttcatcataaattacacacaggagagaaaccttat
aattgtgaggaatgcgggaaggccttcattcacgattcccagcttcaagaacatcagaga
atccatacgggggagaagccattcaaatgtgatatatgtggtaagagcttctgtggtaga
tcaagacttaataggcattccatggttcacacggcagagaaaccattccgatgtgatacg
tgtgataagagctttcgtcagagatcagcacttaatagtcatcgcatgatccacacagga
gagaaaccatacaaatgtgaggagtgtggaaaaggctttatttgtaggcgagatctttat
acgcatcatatggtccacacgggagaaaagccatataattgtaaagagtgtgggaagagc
ttcagatgggcctcgtgtcttttgaaacatcagcgagtccacagtggagaaaaaccattc
aaatgtgaagaatgtgggaaaggattttacacaaattcacaatgctattcccaccagaga
tcccatagtggagaaaaaccatacaaatgtgtggagtgtgggaagggctacaaaaggagg
ttggatcttgactttcaccagcgcgtccatacaggagagaaactgtataattgtaaggaa
tgtgggaagagctttagtcgggccccatgtcttttgaaacatgagagactccacagtgga
gaaaaaccattccaatgtgaagagtgtgggaagagatttactcaaaattcacatcttcat
tcccatcagagagttcacactggagaaaagccatacaaatgtgagaagtgtggaaagggc
tacaatagtaagtttaatcttgatatgcaccagaaggtccacacaggagagagaccatac
aattgtaaggaatgtgggaagagttttggctgggcctcgtgtcttttgaaacatcagaga
ctgcacagtggagaaaaaccattcaaatgtgaagagtgtgggaaaagatttactcagaat
tcacagcttcattctcatcaaagagtgcacactggagaaaagccatacaaatgtgatgag
tgtgggaagggcttcagctggtcctcaactcgtctgacccatcagagacgccacagcaga
gaaacacctctcaaatgtgagcagcatgggaagaacattgtacagaattcattctctaaa
gtgcaagaaaaagttcacagtgtagaaaagccatacaaatgtgaggactgtgggaagggc
tacaacaggcgcttgaatcttgatatgcatcagagggtccacatgggagagaaaacatgg
aagtgtagggagtgtgatatgtgctttagtcaggcctcaagccttcgacttcatcagaat
gttcatgttggagaaaaaccttag

DBGET integrated database retrieval system