KEGG   Homo sapiens (human): 7781
Entry
7781              CDS       T01001                                 

Gene name
SLC30A3, ZNT3
Definition
(RefSeq) solute carrier family 30 member 3
  KO
K14690  solute carrier family 30 (zinc transporter), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7781 (SLC30A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC30: Zinc efflux transporter
   7781 (SLC30A3)
SSDB
Motif
Pfam: Cation_efflux
Other DBs
NCBI-GeneID: 7781
NCBI-ProteinID: NP_003450
OMIM: 602878
HGNC: 11014
Ensembl: ENSG00000115194
Vega: OTTHUMG00000128409
Pharos: Q99726(Tbio)
UniProt: Q99726
Position
2p23.3
AA seq 388 aa
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL
PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL
FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM
LLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL
GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV
GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF
GFSSCTLQVEQYQPEMAQCLRCQEPPQA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggagccctctccagccgctgggggcttggagaccactcgcctggtgagcccccgggac
cgcggtggcgccggaggcagcctgcgtttgaagagtctcttcacagagccctcagagccc
ctccctgaggagtccaaacctgtggagatgcccttccaccactgccacagggaccccctt
ccgccgccgggccttacccctgagaggctgcatgcacggaggcagctatatgctgcctgt
gccgtttgctttgtcttcatggctggggaggtggtcggcgggtatctggcacacagcctg
gccatcatgaccgatgcagcccacttgctggcggatgtgggcagcatgatgggcagcctc
ttctccctctggctctccacccgtccagccacccgcaccatgacctttggctggcaccgt
tcagagactctgggggctttggcctctgtggtctccctctggatggtcactggcatcctc
ctgtacctggccttcgtccgcctgctgcacagcgactaccacatcgaggggggtgccatg
ctgctgaccgccagcatcgcagtctgtgccaacctgttaatggcctttgtgctgcaccag
gctgggcccccccacagccacgggtctaggggagcagagtatgcaccgctggaggagggg
cctgaagagcccctgcccctggggaacaccagcgtccgggcggcatttgtgcacgtgctg
ggggacctcctgcagagctttggggtactggctgcctccatcctcatctacttcaagcct
caatacaaggcagccgaccccatcagcaccttcctcttctccatctgtgcccttggatcc
accgctcccaccctccgagacgttcttcgaatcctcatggaaggtaccccccgcaatgtg
gggttcgaacctgtgcgggatacgctgttgtcggtgccaggagtccgggcaacccatgag
ctgcacctgtgggcccttacgctcacttaccatgttgcctctgcacacctggccatcgac
tccaccgctgaccctgaagccgtcctggctgaagcctcatcccggctctactcccggttt
ggattctccagctgcaccctgcaggtcgagcagtatcagccggagatggcccagtgcctg
cgctgccaggaacccccccaagcctga

DBGET integrated database retrieval system