KEGG   Homo sapiens (human): 7783Help
Entry
7783              CDS       T01001                                 

Gene name
ZP2, OOMD6, ZPA, Zp-2
Definition
(RefSeq) zona pellucida glycoprotein 2
  KO
K19927  zona pellucida sperm-binding protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7783 (ZP2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    7783 (ZP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 7783
NCBI-ProteinID: NP_003451
OMIM: 182888
HGNC: 13188
Ensembl: ENSG00000103310
Vega: OTTHUMG00000090681
Pharos: Q05996(Tbio)
UniProt: Q05996
Position
16p12.3-p12.2
AA seq 745 aa AA seqDB search
MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSGNSIDVSQLVNPAFPGTVTCDEREI
TVEFPSSPGTKKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRV
MNNSAALRHGAVMYQFFCPAMQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKV
QMGWSIEVGDGARAKTLTLPEAMKEGFSLLIDNHRMTFHVPFNATGVTHYVQGNSHLYMV
SLKLTFISPGQKVIFSSQAICAPDPVTCNATHMTLTIPEFPGKLKSVSFENQNIDVSQLH
DNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETVSMVIYPECLC
ESPVSIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIP
LNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVES
LTPPVASVKLGPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKL
VLDDCWATSTMDPDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAF
VSEAHVLSSLVYFHCSALICNRLSPDSPLCSVTCPVSSRHRRATGATEAEKMTVSLPGPI
LLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAV
AAFAGVVATLGFIYYLYEKRTVSNH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcaggcagagaggaggctcttggagtccctcaggctggttcaatgcaggctgg
agcacctacaggtcgatttctctcttcttcgcccttgtgacttcagggaactccatagat
gtttctcagttggtaaatcctgcctttccaggcactgtcacttgcgatgaaagggaaata
acagtggagttcccaagcagtcctggcaccaagaaatggcatgcatctgtggtggatcct
cttggtctcgacatgccgaactgcacttacatcctggacccagaaaagctcaccctgagg
gctacctatgataactgtaccaggagagtgcatggtggacaccagatgaccatcagagtc
atgaacaacagtgctgccttaagacacggagctgtcatgtatcagttcttctgtccagct
atgcaagtagaagagacccaggggctttcagcatctacaatctgccagaaggatttcatg
tctttttccttgccacgggtcttctctggcttggctgacgacagtaaggggaccaaagtt
cagatgggatggagcattgaggttggtgatggtgcaagagccaaaactctgaccctgcca
gaggccatgaaggaaggcttcagcctcttgattgacaaccacaggatgaccttccatgtg
ccattcaatgccactggagtgactcactatgtgcaaggtaacagtcatctctacatggtg
tctctgaagcttacatttatatctcctggacagaaggtgatcttctcttcacaagctatt
tgtgcaccagatcctgtgacctgcaatgccacacacatgactctcaccataccagagttt
cctgggaagcttaagtctgtgagctttgaaaaccagaacattgatgtgagccagctgcat
gacaatggaattgatctagaagcaacaaatggcatgaaattgcatttcagcaaaactctg
ctcaaaacgaaattatctgaaaaatgcctactccatcagttctacttagcttcactcaag
ctgacctttctccttcggccagagacagtatccatggtgatctatcctgagtgtctctgt
gagtcacccgtttctatagttacaggggagctgtgcacccaggatgggtttatggacgtc
gaggtctacagctaccaaacacaaccagctcttgacctgggtactctgagggtgggaaac
tcatcctgccagcctgtctttgaggctcagtctcaggggctggtacggttccacataccc
ctgaatggatgtggaacgagatataagttcgaagatgataaagtcgtctatgaaaacgaa
atacatgctctctggacggattttcctccaagcaaaatatctagagacagtgagttcaga
atgacagtgaagtgttcttatagcaggaatgacatgctactaaacatcaacgttgaaagc
cttactcctccagtggcctcagtgaagttgggtccatttaccttgatcctgcaaagctac
ccagataattcctaccaacaaccttatggggaaaacgagtaccctctagtgagattcctc
cgccaaccaatttacatggaagtgagagtcctaaacagggatgaccccaacatcaagctg
gtcttagatgactgctgggcgacgtccaccatggatccagactctttcccccagtggaac
gttgtcgtggatggctgtgcatatgacctggacaactaccagaccaccttccatccagtc
ggctcctctgtgacccatcctgatcactatcagaggtttgacatgaaggcttttgccttt
gtatcagaagcccacgtgctctctagcctggtctacttccactgcagtgccttaatctgt
aatcgactctcccctgactccccactgtgttctgtgacctgccctgtgtcctctaggcac
aggcgagccacaggggccactgaagcagagaaaatgacagtcagcctcccaggacccatt
ctcctgttgtcagatgactcctcattcagaggtgtcggctcatctgatctaaaagcaagt
gggagcagtggggagaagagtaggagtgaaacaggggaggaggttggctcacgaggtgct
atggacaccaaagggcacaagactgctggagatgttggttccaaagctgtggctgctgtg
gctgcctttgcaggtgtggtggcaactctaggcttcatctactacctgtacgagaaaagg
actgtgtcaaatcactaa

DBGET integrated database retrieval system