KEGG   Homo sapiens (human): 7784Help
Entry
7784              CDS       T01001                                 

Gene name
ZP3, OOMD3, ZP3A, ZP3B, ZPC, Zp-3
Definition
(RefSeq) zona pellucida glycoprotein 3
  KO
K19928  zona pellucida sperm-binding protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7784 (ZP3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    7784 (ZP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 7784
NCBI-ProteinID: NP_001103824
OMIM: 182889
HGNC: 13189
Ensembl: ENSG00000188372
Vega: OTTHUMG00000130575
Pharos: P21754(Tbio)
UniProt: P21754
Position
7q11.23
AA seq 424 aa AA seqDB search
MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLF
GTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDP
RPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEEN
WNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCL
VDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKAC
SFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADV
TVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV
SASE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagctataggctcttcatctgcctcctgctctggggtagtactgagctgtgc
tacccccaacccctctggctcttgcagggtggagccagccatcctgagacgtccgtacag
cccgtactggtggagtgtcaggaggccactctgatggtcatggtcagcaaagaccttttt
ggcaccgggaagctcatcagggctgctgacctcaccttgggcccagaggcctgtgagcct
ctggtctccatggacacagaagatgtggtcaggtttgaggttggactccacgagtgtggc
aacagcatgcaggtaactgacgatgccctggtgtacagcaccttcctgctccatgacccc
cgccccgtgggaaacctgtccatcgtgaggactaaccgcgcagagattcccatcgagtgc
cgctaccccaggcagggcaatgtgagcagccaggccatcctgcccacctggttgcccttc
aggaccacggtgttctcagaggagaagctgactttctctctgcgtctgatggaggagaac
tggaacgctgagaagaggtcccccaccttccacctgggagatgcagcccacctccaggca
gaaatccacactggcagccacgtgccactgcggttgtttgtggaccactgcgtggccaca
ccgacaccagaccagaatgcctccccttatcacaccatcgtggacttccatggctgtctt
gtcgacggtctcactgatgcctcttctgcattcaaagttcctcgacccgggccagataca
ctccagttcacagtggatgtcttccactttgctaatgactccagaaacatgatatacatc
acctgccacctgaaggtcaccctagctgagcaggacccagatgaactcaacaaggcctgt
tccttcagcaagccttccaacagctggttcccagtggaaggctcggctgacatctgtcaa
tgctgtaacaaaggtgactgtggcactccaagccattccaggaggcagcctcatgtcatg
agccagtggtccaggtctgcttcccgtaaccgcaggcatgtgacagaagaagcagatgtc
accgtggggccactgatcttcctggacaggaggggtgaccatgaagtagagcagtgggct
ttgccttctgacacctcagtggtgctgctgggcgtaggcctggctgtggtggtgtccctg
actctgactgctgttatcctggttctcaccaggaggtgtcgcactgcctcccaccctgtg
tctgcttccgaataa

DBGET integrated database retrieval system