KEGG   Homo sapiens (human): 7786Help
Entry
7786              CDS       T01001                                 

Gene name
MAP3K12, DLK, MEKK12, MUK, ZPK, ZPKP1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 12
  KO
K04423  mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7786 (MAP3K12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7786 (MAP3K12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     7786 (MAP3K12)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   7786 (MAP3K12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 7786
NCBI-ProteinID: NP_006292
OMIM: 600447
HGNC: 6851
Ensembl: ENSG00000139625
Vega: OTTHUMG00000169854
Pharos: Q12852(Tchem)
UniProt: Q12852 A0A024RAY5
Structure
PDB: 

Position
12q13.13
AA seq 859 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGG
AAGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEV
PFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVC
TQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSP
NMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVL
WELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQI
LLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGL
LHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRS
RRGKTRHRKASAKGSCGDLPGLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHD
LLLRKMSSSSPDLLSAALGSRGRGATGGAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGG
AKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTPAALLYRAAVTRSQKRGISSE
EEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPSGTPEVGSTNT
DERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST
ELDNSNSVDALRPPASLPP
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcctccatgagacccgaacaccctctccttcctttgggggctttgtgtctacc
ctaagtgaggcatccatgcgcaagctggacccagacacttctgactgcactcccgagaag
gacctgacgcctacccatgtcctgcagctacatgagcaggatgcagggggcccaggggga
gcagctgggtcacctgagagtcgggcatccagagttcgagctgacgaggtgcgactgcag
tgccagagtggcagtggcttccttgagggcctctttggctgcctgcgccctgtctggacc
atgattggcaaagcctactccactgagcacaagcagcagcaggaagacctttgggaggtc
ccctttgaggaaatcctggacctgcagtgggtgggctcaggggcccagggtgctgtcttc
ctggggcgcttccacggggaggaggtggctgtgaagaaggtgcgagacctcaaagaaacc
gacatcaagcacttgcgaaagctgaagcaccccaacatcatcactttcaagggtgtgtgc
acccaggctccctgctactgcatcctcatggagttctgcgcccagggccagctgtatgag
gtactgcgggctggccgccctgtcaccccctccttactggttgactggtccatgggcatc
gctggtggcatgaactacctgcacctgcacaagattatccacagggatctcaagtcaccc
aacatgctaatcacctacgacgatgtggtgaagatctcagattttggcacttccaaggag
ctgagtgacaagagcaccaagatgtcctttgcagggacagtagcctggatggcccctgag
gtgatccgcaatgaacctgtgtctgagaaggtcgacatctggtcctttggcgtggtgcta
tgggaactgctgactggtgagatcccctacaaagacgtagattcctcagccattatctgg
ggtgtgggaagcaacagtctccatctgcccgtgccctccagttgcccagatggtttcaag
atcctgcttcgccagtgctggaatagcaaaccacgaaatcgcccatcattccgacagatc
ctgctgcatctggacattgcctcagctgatgtactctccacaccccaggagacttacttt
aagtcccaggcagagtggcgggaagaagtaaaactgcactttgaaaagattaagtcagaa
gggacctgtctgcaccgcctagaagaggaactggtgatgaggaggagggaggagctcaga
cacgccctggacatcagggagcactatgaaaggaagctggagagagccaacaacctgtat
atggaacttaatgccctcatgttgcagctggaactcaaggagagggagctgctcaggcga
gagcaagctttagagcggaggtgcccaggcctgctgaagccacacccttcccggggcctc
ctgcatggaaacacaatggagaagcttatcaagaagaggaatgtgccacagaagctgtca
ccccatagcaaaaggccagatatcctcaagacggagtctttgctccctaaactagatgca
gccctgagtggggtggggcttcctgggtgtcctaagggccccccctcaccaggacggagt
cgccgtggcaagacccgtcaccgcaaggccagcgccaaggggagctgtggggacctgcct
gggcttcgtacagctgtgccaccccatgaacctggaggaccaggaagcccagggggccta
ggagggggaccctcagcctgggaggcctgccctcccgccctccgtgggcttcatcatgac
ctcctgctccgcaaaatgtcttcatcgtccccagacctgctgtcagcagcactagggtcc
cggggccggggggccacaggcggagctggggatcctggctcaccacctccggcccggggt
gacaccccaccaagtgagggctcagcccctggctccaccagcccagattcacctggggga
gccaaaggggaaccacctcctccagtagggcctggtgaaggtgtggggcttctgggaact
ggaagggaagggacctcaggccggggaggaagccgggctgggtcccagcacttgacccca
gctgcactgctgtacagggctgccgtcacccgaagtcagaaacgtggcatctcatcggaa
gaggaggaaggagaggtagacagtgaagtagagctgacatcaagccagaggtggcctcag
agcctgaacatgcgccagtcactatctaccttcagctcagagaatccatcagatggggag
gaaggcacagctagtgaaccttcccccagtggcacacctgaagttggcagcaccaacact
gatgagcggccagatgagcggtctgatgacatgtgctcccagggctcagaaatcccactg
gacccacctccttcagaggtcatccctggccctgaacccagctccctgcccattccacac
caggaacttctcagagagcggggccctcccaattctgaggactcagactgtgacagcact
gaattggacaactccaacagcgttgatgccttgcggcccccagcttccctccctccatga

DBGET integrated database retrieval system