KEGG   Homo sapiens (human): 780Help
Entry
780               CDS       T01001                                 

Gene name
DDR1, CAK, CD167, DDR, EDDR1, HGK2, MCK10, NEP, NTRK4, PTK3, PTK3A, RTK6, TRKE
Definition
(RefSeq) discoidin domain receptor tyrosine kinase 1
  KO
K05124  discoidin domain receptor family member 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    780 (DDR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    780 (DDR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780 (DDR1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  DDR family
   780 (DDR1)
CD molecules [BR:hsa04090]
 Proteins
  780 (DDR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F5_F8_type_C Lamprin Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 780
NCBI-ProteinID: NP_001284583
OMIM: 600408
HGNC: 2730
Ensembl: ENSG00000204580
Vega: OTTHUMG00000031236
Pharos: Q08345(Tchem)
UniProt: Q08345 A0A024RCL1
Structure
PDB: 

Position
6p21.33
AA seq 913 aa AA seqDB search
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgggaccagaggccctgtcatctttactgctgctgctcttggtggcaagtggagatgct
gacatgaagggacattttgatcctgccaagtgccgctatgccctgggcatgcaggaccgg
accatcccagacagtgacatctctgcttccagctcctggtcagattccactgccgcccgc
cacagcaggttggagagcagtgacggggatggggcctggtgccccgcagggtcggtgttt
cccaaggaggaggagtacttgcaggtggatctacaacgactgcacctggtggctctggtg
ggcacccagggacggcatgccgggggcctgggcaaggagttctcccggagctaccggctg
cgttactcccgggatggtcgccgctggatgggctggaaggaccgctggggtcaggaggtg
atctcaggcaatgaggaccctgagggagtggtgctgaaggaccttgggccccccatggtt
gcccgactggttcgcttctacccccgggctgaccgggtcatgagcgtctgtctgcgggta
gagctctatggctgcctctggagggatggactcctgtcttacaccgcccctgtggggcag
acaatgtatttatctgaggccgtgtacctcaacgactccacctatgacggacataccgtg
ggcggactgcagtatgggggtctgggccagctggcagatggtgtggtggggctggatgac
tttaggaagagtcaggagctgcgggtctggccaggctatgactatgtgggatggagcaac
cacagcttctccagtggctatgtggagatggagtttgagtttgaccggctgagggccttc
caggctatgcaggtccactgtaacaacatgcacacgctgggagcccgtctgcctggcggg
gtggaatgtcgcttccggcgtggccctgccatggcctgggagggggagcccatgcgccac
aacctagggggcaacctgggggaccccagagcccgggctgtctcagtgccccttggcggc
cgtgtggctcgctttctgcagtgccgcttcctctttgcggggccctggttactcttcagc
gaaatctccttcatctctgatgtggtgaacaattcctctccggcactgggaggcaccttc
ccgccagccccctggtggccgcctggcccacctcccaccaacttcagcagcttggagctg
gagcccagaggccagcagcccgtggccaaggccgaggggagcccgaccgccatcctcatc
ggctgcctggtggccatcatcctgctcctgctgctcatcattgccctcatgctctggcgg
ctgcactggcgcaggctcctcagcaaggctgaacggagggtgttggaagaggagctgacg
gttcacctctctgtccctggggacactatcctcatcaacaaccgcccaggtcctagagag
ccacccccgtaccaggagccccggcctcgtgggaatccgccccactccgctccctgtgtc
cccaatggctctgcgttgctgctctccaatccagcctaccgcctccttctggccacttac
gcccgtccccctcgaggcccgggcccccccacacccgcctgggccaaacccaccaacacc
caggcctacagtggggactatatggagcctgagaagccaggcgccccgcttctgccccca
cctccccagaacagcgtcccccattatgccgaggctgacattgttaccctgcagggcgtc
accgggggcaacacctatgctgtgcctgcactgcccccaggggcagtcggggatgggccc
cccagagtggatttccctcgatctcgactccgcttcaaggagaagcttggcgagggccag
tttggggaggtgcacctgtgtgaggtcgacagccctcaagatctggttagtcttgatttc
ccccttaatgtgcgtaagggacaccctttgctggtagctgtcaagatcttacggccagat
gccaccaagaatgccaggaatgatttcctgaaagaggtgaagatcatgtcgaggctcaag
gacccaaacatcattcggctgctgggcgtgtgtgtgcaggacgaccccctctgcatgatt
actgactacatggagaacggcgacctcaaccagttcctcagtgcccaccagctggaggac
aaggcagccgagggggcccctggggacgggcaggctgcgcaggggcccaccatcagctac
ccaatgctgctgcatgtggcagcccagatcgcctccggcatgcgctatctggccacactc
aactttgtacatcgggacctggccacgcggaactgcctagttggggaaaatttcaccatc
aaaatcgcagactttggcatgagccggaacctctatgctggggactattaccgtgtgcag
ggccgggcagtgctgcccatccgctggatggcctgggagtgcatcctcatggggaagttc
acgactgcgagtgacgtgtgggcctttggtgtgaccctgtgggaggtgctgatgctctgt
agggcccagccctttgggcagctcaccgacgagcaggtcatcgagaacgcgggggagttc
ttccgggaccagggccggcaggtgtacctgtcccggccgcctgcctgcccgcagggccta
tatgagctgatgcttcggtgctggagccgggagtctgagcagcgaccacccttttcccag
ctgcatcggttcctggcagaggatgcactcaacacggtgtga

DBGET integrated database retrieval system