KEGG   Homo sapiens (human): 7804Help
Entry
7804              CDS       T01001                                 

Gene name
LRP8, APOER2, HSZ75190, LRP-8, MCI1
Definition
(RefSeq) LDL receptor related protein 8
  KO
K20052  low-density lipoprotein receptor-related protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7804 (LRP8)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    7804 (LRP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition SGL cEGF EGF_CA DUF5050 TMEM154 SKG6 EGF_3 DUF4448 PAP_PilO
Motif
Other DBs
NCBI-GeneID: 7804
NCBI-ProteinID: NP_004622
OMIM: 602600
HGNC: 6700
Ensembl: ENSG00000157193
Vega: OTTHUMG00000008924
Pharos: Q14114(Tbio)
UniProt: Q14114
Structure
PDB: 

Position
1p32.3
AA seq 963 aa AA seqDB search
MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCL
AAVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGGACIPERWVCDRQFDCEDRSDE
AAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCR
GDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFEC
TCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMD
KASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLS
EPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYW
VDSKLHQLSSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGL
EISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCA
CPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTYQNHSTETPSL
TAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRP
LWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDD
GLP
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccgagccgggccctctccggcttctggcgctgctgctgctgctgctgctg
ctgctgctgctgcagctccagcatcttgcggcggcagcggctgatccgctgctcggcggc
caagggccggccaaggattgcgaaaaggaccaattccagtgccggaacgagcgctgcatc
ccctctgtgtggagatgcgacgaggacgatgactgcttagaccacagcgacgaggacgac
tgccccaagaagacctgtgcagacagtgacttcacctgtgacaacggccactgcatccac
gaacggtggaagtgtgacggcgaggaggagtgtcctgatggctccgatgagtccgaggcc
acttgcaccaagcaggtgtgtcctgcagagaagctgagctgtggacccaccagccacaag
tgtgtacctgcctcgtggcgctgcgacggggagaaggactgcgagggtggagcggatgag
gccggctgtgctaccttgtgcgccccgcacgagttccagtgcggcaaccgctcgtgcctg
gccgccgtgttcgtgtgcgacggcgacgacgactgtggtgacggcagcgatgagcgcggc
tgtgcagacccggcctgcgggccccgcgagttccgctgcggcggcgatggcggcggcgcc
tgcatcccggagcgctgggtctgcgaccgccagtttgactgcgaggaccgctcggacgag
gcagccgagctctgcggccgtccgggccccggggccacgtccgcgcccgccgcctgcgcc
accgcctcccagttcgcctgccgcagcggcgagtgcgtgcacctgggctggcgctgcgac
ggcgaccgcgactgcaaagacaaatcggacgaggccgactgcccactgggcacctgccgt
ggggacgagttccagtgtggggatgggacatgtgtccttgcaatcaagcactgcaaccag
gagcaggactgtccagatgggagtgatgaagctggctgcctacaggggctgaacgagtgt
ctgcacaacaatggcggctgctcacacatctgcactgacctcaagattggctttgaatgc
acgtgcccagcaggcttccagctcctggaccagaagacctgtggcgacattgatgagtgc
aaggacccagatgcctgcagccagatctgtgtcaattacaagggctattttaagtgtgag
tgctaccctggctacgagatggacctactgaccaagaactgcaaggctgctgctggcaag
agcccatccctaatcttcaccaaccggcacgaggtgcggaggatcgacctggtgaagcgg
aactattcacgcctcatccccatgctcaagaatgtcgtggcactagatgtggaagttgcc
accaatcgcatctactggtgtgacctctcctaccgtaagatctatagcgcctacatggac
aaggccagtgacccgaaagagcaggaggtcctcattgacgagcagttgcactctccagag
ggcctggcagtggactgggtccacaagcacatctactggactgactcgggcaataagacc
atctcagtggccacagttgatggtggccgccgacgcactctcttcagccgtaacctcagt
gaaccccgggccatcgctgttgaccccctgcgagggttcatgtattggtctgactggggg
gaccaggccaagattgagaaatctgggctcaacggtgtggaccggcaaacactggtgtca
gacaatattgaatggcccaacggaatcaccctggatctgctgagccagcgcttgtactgg
gtagactccaagctacaccaactgtccagcattgacttcagtggaggcaacagaaagacg
ctgatctcctccactgacttcctgagccacccttttgggatagctgtgtttgaggacaag
gtgttctggacagacctggagaacgaggccattttcagtgcaaatcggctcaatggcctg
gaaatctccatcctggctgagaacctcaacaacccacatgacattgtcatcttccatgag
ctgaagcagccaagagctccagatgcctgtgagctgagtgtccagcctaatggaggctgt
gaatacctgtgccttcctgctcctcagatctccagccactctcccaagtacacatgtgcc
tgtcctgacacaatgtggctgggtccagacatgaagaggtgctaccgagcacctcaatct
acctcaactacgacgttagcttctaccatgacgaggacagtacctgccaccacaagagcc
cccgggaccaccgtccacagatccacctaccagaaccacagcacagagacaccaagcctg
acagctgcagtcccaagctcagttagtgtccccagggctcccagcatcagcccgtctacc
ctaagccctgcaaccagcaaccactcccagcactatgcaaatgaagacagtaagatgggc
tcaacagtcactgccgctgttatcgggatcatcgtgcccatagtggtgatagccctcctg
tgcatgagtggatacctgatctggagaaactggaagcggaagaacaccaaaagcatgaat
tttgacaacccagtctacaggaaaacaacagaagaagaagacgaagatgagctccatata
gggagaactgctcagattggccatgtctatcctgcagcaatcagcagctttgatcgccca
ctgtgggcagagccctgtcttggggagaccagagaaccggaagacccagcccctgccctc
aaggagctttttgtcttgccgggggaaccaaggtcacagctgcaccaactcccgaagaac
cctctttccgagctgcctgtcgtcaaatccaagcgagtggcattaagccttgaagatgat
ggactaccctga

DBGET integrated database retrieval system