KEGG   Homo sapiens (human): 7812
Entry
7812              CDS       T01001                                 
Symbol
CSDE1, D1S155E, UNR
Name
(RefSeq) cold shock domain containing E1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CSD SUZ-C S1-like CusF_Ec
Other DBs
NCBI-GeneID: 7812
NCBI-ProteinID: NP_001007554
OMIM: 191510
HGNC: 29905
Ensembl: ENSG00000009307
Pharos: O75534(Tbio)
UniProt: O75534 A0A024R0E2
Structure
Position
1:complement(114716916..114757984)
AA seq 798 aa
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNL
QDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAP
GQSPTGSVCYERNGEVFYLTYTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLK
KKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKE
VATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQNDPLPGRIKVDFVIPKELPFG
DKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREMGVIAAMRDGF
GFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGS
TSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDK
EIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGK
VIRPLRSVDPTQTEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLG
QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFS
VILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPD
NSMGFGAERKIRQAGVID
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagctttgatccaaaccttctccacaacaatggacataatgggtaccctaatggtact
tcagcagcactgcgtgaaactggggttattgaaaaactgttaacctcttacggatttatt
cagtgttcagaacgtcaagctagacttttcttccactgttcacagtataatggcaacctg
caagacttaaaagtaggagatgatgttgaatttgaagtatcatcggaccgacggactggg
aaacccattgctgttaaactggtgaagataaaacaagaaatcctccctgaagaacgaatg
aatggacaagttgtgtgcgctgttcctcacaacttagagagtaaatctccagctgccccg
ggtcagagtccaacagggagtgtatgctacgaacgtaatggggaagtgttttatctgact
tacacccctgaagatgtcgaagggaacgttcagctggaaactggagataaaataaacttt
gtaattgataacaataaacatactggtgctgtaagtgctcgcaacattatgctgttgaaa
aagaaacaagcccgctgtcagggagtagtttgtgccatgaaggaggcatttggctttatt
gaaagaggtgatgttgtaaaagagatattctttcactatagtgaatttaagggtgactta
gaaaccttacagcctggcgatgatgtggaattcacaatcaaggacagaaatggtaaagaa
gttgcaacagatgtcagactattgcctcaaggaacagtcatttttgaagatatcagcatt
gaacattttgaaggaactgtaaccaaagttatcccaaaagtacccagtaaaaaccagaat
gacccattgccaggacgcatcaaagttgactttgtgatccctaaagaacttccctttgga
gacaaagatacgaaatccaaggtgaccctgctggaaggtgaccatgttaggtttaatatt
tcaacagaccgacgtgacaaattagagcgagcaaccaatatagaagttctgtcaaataca
tttcagttcactaatgaagcccgagaaatgggtgtgattgctgccatgagagatggtttt
ggtttcatcaagtgtgtggatcgtgatgttcgtatgttcttccacttcagtgaaattctg
gatgggaaccagctccatattgcagatgaagtagagtttactgtggttcctgatatgctc
tctgctcaaagaaatcatgctattaggattaaaaaacttcccaagggcacggtttcattt
cattcccattcagatcaccgttttctgggcacggtagaaaaagaagccactttttccaat
cctaaaaccactagcccaaataaaggcaaagagaaggaggctgaggatggcattattgct
tatgatgactgtggggtgaaactgactattgcttttcaagccaaggatgtggaaggatct
acttctcctcaaataggagataaggttgaatttagtattagtgacaaacagaggcctgga
cagcaggttgcaacttgtgtgcgacttttaggtcgtaattctaactccaagaggctcttg
ggttatgtggcaactctgaaggataattttggatttattgaaacagccaatcatgataag
gaaatctttttccattacagtgagttctctggtgatgttgatagcctggaactgggggac
atggtcgagtatagcttgtccaaaggcaaaggcaacaaagtcagtgcagaaaaagtgaac
aaaacacactcagtgaatggcattactgaggaagctgatcccaccatttactctggcaaa
gtaattcgccccctgaggagtgttgatccaacacagactgagtaccaaggaatgattgag
attgtggaggagggcgatatgaaaggtgaggtctatccatttggcatcgttgggatggcc
aacaaaggggattgcctgcagaaaggggagagcgtcaagttccaattgtgtgtcctgggc
caaaatgcacaaactatggcttacaacatcacacccctgcgcagggccacagtggaatgt
gtgaaagatcagtttggcttcattaactatgaagtaggagatagcaagaagctctttttc
catgtgaaagaagttcaggatggcattgagctacaggcaggagatgaggtggagttctca
gtgattcttaatcagcgcactggcaagtgcagcgcctgtaatgtttggcgagtctgtgag
ggccccaaggctgttgcagctcctcgacctgatcggttggtcaatcgcttgaagaatatc
actctggatgatgccagtgctcctcgcctaatggttcttcgtcagccaaggggaccagat
aactcaatggggtttggtgcagaaagaaagatccgtcaagctggtgtcattgactaa

DBGET integrated database retrieval system