KEGG   Homo sapiens (human): 783Help
Entry
783               CDS       T01001                                 

Gene name
CACNB2, CACNLB2, CAVB2, MYSB
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit beta 2
  KO
K04863  voltage-dependent calcium channel beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00728  Brugada syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    783 (CACNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    783 (CACNB2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    783 (CACNB2)
   04261 Adrenergic signaling in cardiomyocytes
    783 (CACNB2)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    783 (CACNB2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    783 (CACNB2)
   05414 Dilated cardiomyopathy (DCM)
    783 (CACNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    783 (CACNB2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   783 (CACNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 783
NCBI-ProteinID: NP_963890
OMIM: 600003
HGNC: 1402
Ensembl: ENSG00000165995
Vega: OTTHUMG00000017764
Pharos: Q08289(Tbio)
UniProt: Q08289
Position
10p12.33-p12.31
AA seq 660 aa AA seqDB search
MVQRDMSKSPPTAAAAVAQEIQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIER
IFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLN
VQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPLLSRTL
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHN
HRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
RHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggtccaaagggacatgtccaagtcgcctcccacagcggcggcggcggtggcgcaggag
atccagatggaactgctagagaacgtggctcccgcgggggcgctcggagccgccgcacag
tcatatggaaaaggagccagaaggaaaaacagatttaaaggatctgatggaagcacgtca
tctgatactacctcaaatagttttgttcgccagggttcggcagactcctacactagccgt
ccatccgattccgatgtatctctggaggaggaccgggaggcagtgcgcagagaagcggag
cggcaggcccaggcacagttggaaaaagcaaagacaaagcccgttgcatttgcggttcgg
acaaatgtcagctacagtgcggcccatgaagatgatgttccagtgcctggcatggccatc
tcattcgaagcaaaagattttctgcatgttaaggaaaaatttaacaatgactggtggata
gggcgattggtaaaagaaggctgtgaaatcggattcattccaagcccagtcaaactagaa
aacatgaggctgcagcatgaacagagagccaagcaagggaaattctactccagtaaatca
ggaggaaattcatcatccagtttgggtgacatagtacctagttccagaaaatcaacacct
ccatcatctgctatagacatagatgctactggcttagatgcagaagaaaatgatattcca
gcaaaccaccgctcccctaaacccagtgcaaacagtgtaacgtcaccccactccaaagag
aaaagaatgcccttctttaagaagacagagcacactcctccgtatgatgtggtaccttcc
atgcgaccagtggtcctagtgggcccttctctgaagggctacgaggtcacagatatgatg
caaaaagcgctgtttgattttttaaaacacagatttgaagggcggatatccatcacaagg
gtcaccgctgacatctcgcttgccaaacgctcggtattaaacaatcccagtaagcacgca
ataatagaaagatccaacacaaggtcaagcttagcggaagttcagagtgaaatcgaaagg
atttttgaacttgcaagaacattgcagttggtggtccttgacgcggatacaattaatcat
ccagctcaactcagtaaaacctccttggcccctattatagtatatgtaaagatttcttct
cctaaggttttacaaaggttaataaaatctcgagggaaatctcaagctaaacacctcaac
gtccagatggtagcagctgataaactggctcagtgtcctccagagctgttcgatgtgatc
ttggatgagaaccagcttgaggatgcctgtgagcaccttgccgactatctggaggcctac
tggaaggccacccatcctcccagcagtagcctccccaaccctctccttagccgtacatta
gccacttcaagtctgcctcttagccccaccctagcctctaattcacagggttctcaaggt
gatcagaggactgatcgctccgctcctatccgttctgcttcccaagctgaagaagaacct
agtgtggaaccagtcaagaaatcccagcaccgctcttcctcctcagccccacaccacaac
catcgcagtgggacaagtcgcggcctctccaggcaagagacatttgactcggaaacccag
gagagtcgagactctgcctacgtagagccaaaggaagattattcccatgaccacgtggac
cactatgcctcacaccgtgaccacaaccacagagacgagacccacgggagcagtgaccac
agacacagggagtcccggcaccgttcccgggacgtggatcgagagcaggaccacaacgag
tgcaacaagcagcgcagccgtcataaatccaaggatcgctactgtgaaaaggatggagaa
gtgatatcaaaaaaacggaatgaggctggggagtggaacagggatgtttacatccgccaa
tga

DBGET integrated database retrieval system