KEGG   Homo sapiens (human): 7841
Entry
7841              CDS       T01001                                 

Gene name
MOGS, CDG2B, CWH41, DER7, GCS1
Definition
(RefSeq) mannosyl-oligosaccharide glucosidase
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
N00823  MOGS deficiency in N-glycan biosynthesis
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    7841 (MOGS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7841 (MOGS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7841 (MOGS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     7841 (MOGS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7841 (MOGS)
SSDB
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N
Other DBs
NCBI-GeneID: 7841
NCBI-ProteinID: NP_006293
OMIM: 601336
HGNC: 24862
Ensembl: ENSG00000115275
Vega: OTTHUMG00000152886
Pharos: Q13724(Tbio)
UniProt: Q13724 A0A384MDR6
Position
2p13.1
AA seq 837 aa
MARGERRRRAVPAEGVRTAERAARGGPGRRDGRGGGPRSTAGGVALAVVVLSLALGMSGR
WVLAWYRARRAVTLHSAPPVLPADSSSPAVAPDLFWGTYRPHVYFGMKTRSPKPLLTGLM
WAQQGTTPGTPKLRHTCEQGDGVGPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQH
GGDWSWRVTVEPQDSGTSALPLVSLFFYVVTDGKEVLLPEVGAKGQLKFISGHTSELGDF
RFTLLPPTSPGDTAPKYGSYNVFWTSNPGLPLLTEMVKSRLNSWFQHRPPGAPPERYLGL
PGSLKWEDRGPSGQGQGQFLIQQVTLKIPISIEFVFESGSAQAGGNQALPRLAGSLLTQA
LESHAEGFRERFEKTFQLKEKGLSSGEQVLGQAALSGLLGGIGYFYGQGLVLPDIGVEGS
EQKVDPALFPPVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRWDPSLTREALGHWLGLLNA
DGWIGREQILGDEARARVPPEFLVQRAVHANPPTLLLPVAHMLEVGDPDDLAFLRKALPR
LHAWFSWLHQSQAGPLPLSYRWRGRDPALPTLLNPKTLPSGLDDYPRASHPSVTERHLDL
RCWVALGARVLTRLAEHLGEAEVAAELGPLAASLEAAESLDELHWAPELGVFADFGNHTK
AVQLKPRPPQGLVRVVGRPQPQLQYVDALGYVSLFPLLLRLLDPTSSRLGPLLDILADSR
HLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALGALHHYGHLEGPHQARA
AKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLVLLAMAEDY
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggctcggggcgagcggcggcgccgcgcagtgccggcagagggagtgcggacagccgag
agggcggctcggggaggccccgggcgacgggacggccggggcggcgggccgcgtagcacg
gctggaggagtggctctggccgtcgtggtcctgtctttggccctgggtatgtcggggcgc
tgggtgctggcgtggtaccgtgcgcggcgggcggtcacgctgcactccgcgcctcctgtg
ttgcctgccgactcctccagccccgccgtggccccggacctcttctggggaacctaccgc
cctcacgtctacttcggcatgaagacccgcagcccgaagcccctcctcaccggactgatg
tgggcgcagcagggcaccaccccggggactcctaagctcaggcacacgtgtgagcagggg
gacggtgtgggtccctatggctgggagttccacgacggcctctccttcgggcgccaacac
atccaggatggggccttaaggctcaccactgagttcgtcaagaggcctgggggtcagcac
ggaggggactggagctggagagtgactgtagagcctcaggactcaggtacttctgccctc
cctttggtctccctgttcttctatgtggtgacagatggcaaggaagtcctactaccagag
gttggggccaaggggcagttgaagtttatcagtgggcacaccagtgaacttggtgacttc
cgctttacacttttgccaccaaccagtccaggggatacagcccccaagtatggcagctac
aatgtcttctggacctccaacccaggactgcccctgctgacagagatggtaaagagtcgc
ctaaatagctggtttcagcatcggcccccaggggccccccctgaacgctacctcggcttg
ccaggatccctgaagtgggaggacagaggtccaagtgggcaagggcaggggcagttcttg
atacagcaggtgaccctgaaaattcccatttccatagagtttgtgtttgaatcaggcagt
gcccaggcaggaggaaatcaagccctgccaagactggcaggcagtctactgacccaggcc
ctggagagccatgctgaaggctttagagagcgctttgagaagaccttccagctgaaggag
aagggcctgagctctggcgagcaggttttgggtcaggctgccctcagcggcctccttggt
ggaattggctacttctacggacaagggctggtattgccagacatcggggtggaagggtct
gagcagaaggtggacccagccctctttccacccgtacctctttttacagcagtgccctcc
cggtcattcttcccacgaggcttcctttgggatgaaggctttcaccagctggtggttcag
cggtgggatccctccctcacccgggaagcccttggccactggctggggctgctaaatgct
gatggctggattgggagggagcagatactgggggatgaggcccgagcccgggtgcctcca
gaattcctagtacaacgagcagtccacgccaaccccccaaccctacttttgcctgtagcc
catatgctagaggttggtgaccctgacgacttggctttcctccgaaaggccttgccccgc
ctgcatgcctggttttcctggctccatcagagccaggcaggcccactgccactatcttac
cgctggcggggacgggaccctgccttaccaaccttactgaaccccaagaccctaccctct
gggctggatgactacccccgggcttcacacccttcagtaaccgagcggcacctggacctg
cgatgttgggtggcactgggtgcccgtgtgctgacgcggctggcagagcatctgggtgag
gctgaggtagctgctgagctgggcccactggctgcctcactggaggcagcagagagcctg
gatgagctgcactgggccccagagctaggagtctttgcagactttgggaaccacacaaaa
gcagtacagctgaagcccaggccccctcaggggctcgttcgggtggtgggtcggccccaa
cctcaactgcagtatgtagatgctcttggctatgtcagtctttttcccttgctgctgcga
ctgctggaccccacctcatcccgccttgggcccctgctggacattctagccgacagccgc
catctctggagcccctttggtttacgctcccttgcagcctccagctccttttatggccag
cgcaattcagagcatgatcccccctactggcggggtgctgtgtggctcaatgtcaactac
ctggctttgggagcactccaccactatgggcatctggagggtcctcaccaggctcgggct
gccaaactccacggtgagctccgtgccaacgtggtaggcaatgtatggcgccagtaccag
gctacaggctttctttgggagcagtacagtgaccgcgatgggcgaggcatgggctgccgc
cctttccacggctggaccagccttgtcttactggccatggctgaagactactga

DBGET integrated database retrieval system