KEGG   Homo sapiens (human): 7849Help
Entry
7849              CDS       T01001                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
Network
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
Disease
H00032  Thyroid cancer
H00250  Congenital nongoitrous hypothyroidism (CHNG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    7849 (PAX8)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    7849 (PAX8)
   05202 Transcriptional misregulation in cancers
    7849 (PAX8)
   05216 Thyroid cancer
    7849 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7849 (PAX8)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    7849 (PAX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_28 HTH_Tnp_IS1 Ribosomal_S13_N
Motif
Other DBs
NCBI-GeneID: 7849
NCBI-ProteinID: NP_003457
OMIM: 167415
HGNC: 8622
Ensembl: ENSG00000125618
Vega: OTTHUMG00000128529
Pharos: Q06710(Tbio)
UniProt: Q06710 R9W7C9
Structure
PDB: 

Position
2q14.1
AA seq 450 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggagggctgaaccagctgggaggggccttt
gtgaatggcagacctctgccggaagtggtccgccagcgcatcgtagacctggcccaccag
ggtgtaaggccctgcgacatctctcgccagctccgcgtcagccatggctgcgtcagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgccagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaatagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagtcccggacacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcagcgacaagaggaaaatggatgac
agtgatcaggatagctgccgactaagcattgactcacagagcagcagcagcggaccccga
aagcaccttcgcacggatgccttcagccagcaccacctcgagccgctcgagtgcccattt
gagcggcagcactacccagaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccgctgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgccactggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcactcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtcccg
cccttcaatgcctttccccatgctgcctccgtgtacgggcagttcacgggccaggccctc
ctctcagggcgagagatggtggggcccacgctgcccggatacccaccccacatccccacc
agcggacagggcagctatgcctcctctgccatcgcaggcatggtggcaggaagtgaatac
tctggcaatgcctatggccacaccccctactcctcctacagcgaggcctggcgcttcccc
aactccagcttgctgagttccccatattattacagttccacatcaaggccgagtgcaccg
cccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system