KEGG   Homo sapiens (human): 7849Help
Entry
7849              CDS       T01001                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04918  Thyroid hormone synthesis
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
Network
N00126  PAX8-PPARG fusion to PPARG-mediated transcription
Disease
H00032  Thyroid cancer
H00250  Congenital nongoitrous hypothyroidism (CHNG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    7849 (PAX8)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7849 (PAX8)
   05202 Transcriptional misregulation in cancer
    7849 (PAX8)
  09162 Cancers: Specific types
   05216 Thyroid cancer
    7849 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7849 (PAX8)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    7849 (PAX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 7849
NCBI-ProteinID: NP_003457
OMIM: 167415
HGNC: 8622
Ensembl: ENSG00000125618
Vega: OTTHUMG00000128529
Pharos: Q06710(Tbio)
UniProt: Q06710 R9W7C9
Structure
PDB: 

Position
2q14.1
AA seq 450 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactccatcagatctggccatggagggctgaaccagctgggaggggccttt
gtgaatggcagacctctgccggaagtggtccgccagcgcatcgtagacctggcccaccag
ggtgtaaggccctgcgacatctctcgccagctccgcgtcagccatggctgcgtcagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagattggggactacaaacgccagaaccct
accatgtttgcctgggagatccgagaccggctcctggctgagggcgtctgtgacaatgac
actgtgcccagtgtcagctccattaatagaatcatccggaccaaagtgcagcaaccattc
aacctccctatggacagctgcgtggccaccaagtccctgagtcccggacacacgctgatc
cccagctcagctgtaactcccccggagtcaccccagtcggattccctgggctccacctac
tccatcaatgggctcctgggcatcgctcagcctggcagcgacaagaggaaaatggatgac
agtgatcaggatagctgccgactaagcattgactcacagagcagcagcagcggaccccga
aagcaccttcgcacggatgccttcagccagcaccacctcgagccgctcgagtgcccattt
gagcggcagcactacccagaggcctatgcctcccccagccacaccaaaggcgagcagggc
ctctacccgctgcccttgctcaacagcaccctggacgacgggaaggccaccctgacccct
tccaacacgccactggggcgcaacctctcgactcaccagacctaccccgtggtggcagat
cctcactcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctccacc
ccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtcccg
cccttcaatgcctttccccatgctgcctccgtgtacgggcagttcacgggccaggccctc
ctctcagggcgagagatggtggggcccacgctgcccggatacccaccccacatccccacc
agcggacagggcagctatgcctcctctgccatcgcaggcatggtggcaggaagtgaatac
tctggcaatgcctatggccacaccccctactcctcctacagcgaggcctggcgcttcccc
aactccagcttgctgagttccccatattattacagttccacatcaaggccgagtgcaccg
cccaccactgccacggcctttgaccatctgtag

DBGET integrated database retrieval system