KEGG   Homo sapiens (human): 7850
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Drug target
Anakinra: D02934
Isunakinra: D11759
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7850 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7850 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    7850 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    7850 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7850 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7850 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7850 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7850 (IL1R2)
   04090 CD molecules [BR:hsa04090]
    7850 (IL1R2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   7850 (IL1R2)
CD molecules [BR:hsa04090]
 Proteins
  7850 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Izumo-Ig Ig_5
Other DBs
NCBI-GeneID: 7850
NCBI-ProteinID: NP_004624
OMIM: 147811
HGNC: 5994
Ensembl: ENSG00000115590
Vega: OTTHUMG00000130695
Pharos: P27930(Tbio)
UniProt: P27930
Structure
PDB: 
3O4O

Position
2q11.2
AA seq 398 aa
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataataccctgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcatcatcaagactttcaatcctatcccaagtga

DBGET integrated database retrieval system