KEGG   Homo sapiens (human): 7852Help
Entry
7852              CDS       T01001                                 

Gene name
CXCR4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS
Definition
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
Disease
H00097  Chemokine receptor defect
Drug target
Plerixafor: D08971
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7852 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7852 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7852 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7852 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7852 (CXCR4)
   04672 Intestinal immune network for IgA production
    7852 (CXCR4)
   04062 Chemokine signaling pathway
    7852 (CXCR4)
  09158 Development
   04360 Axon guidance
    7852 (CXCR4)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    7852 (CXCR4)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    7852 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7852 (CXCR4)
   04050 Cytokine receptors [BR:hsa04050]
    7852 (CXCR4)
   04090 CD Molecules [BR:hsa04090]
    7852 (CXCR4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    7852 (CXCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   7852 (CXCR4)
CD molecules [BR:hsa04090]
 Proteins
  7852 (CXCR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 7852
NCBI-ProteinID: NP_003458
OMIM: 162643
HGNC: 2561
Ensembl: ENSG00000121966
Vega: OTTHUMG00000153583
Pharos: P61073(Tclin)
UniProt: P61073
Structure
PDB: 

Position
2q22.1
AA seq 352 aa AA seqDB search
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaggggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttcaataaaatcttc
ctgcccaccatctactccatcatcttcttaactggcattgtgggcaatggattggtcatc
ctggtcatgggttaccagaagaaactgagaagcatgacggacaagtacaggctgcacctg
tcagtggccgacctcctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccatcgtccac
gccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgctgactattcccgacttcatctttgccaacgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtattgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttcttcgcctgttggctgccttactacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgaggtggacattcatctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system