KEGG   Homo sapiens (human): 786Help
Entry
786               CDS       T01001                                 

Gene name
CACNG1, CACNLG
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 1
  KO
K04866  voltage-dependent calcium channel gamma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    786 (CACNG1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    786 (CACNG1)
  Circulatory system
   04260 Cardiac muscle contraction
    786 (CACNG1)
   04261 Adrenergic signaling in cardiomyocytes
    786 (CACNG1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    786 (CACNG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    786 (CACNG1)
   05414 Dilated cardiomyopathy (DCM)
    786 (CACNG1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   786 (CACNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin Acyl_transf_3 DUF981 UL45
Motif
Other DBs
NCBI-GeneID: 786
NCBI-ProteinID: NP_000718
OMIM: 114209
HGNC: 1405
Ensembl: ENSG00000108878
Vega: OTTHUMG00000179553
Pharos: Q06432(Tbio)
UniProt: Q06432
Position
17q24.2
AA seq 222 aa AA seqDB search
MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKR
IPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIL
GSLCVLLSLGKKRDYLLRPASMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSW
SFACACAAFILLFLGGLALLLFSLPRMPRNPWESCMDAEPEH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaccaaaatgctgaaggtccgcgtgaccctcttctgcatcctggcaggcatc
gtgctggccatgacagccgtggtaaccgaccactgggctgtgctgagcccccacatggag
caccacaacactacctgcgaggcggcccacttcggcctctggcggatttgtaccaagcgc
atccccatggacgacagcaagacctgcgggcccatcaccctgcccggggagaagaactgt
tcctacttcaggcattttaaccccggcgagagctcggagatcttcgaattcaccactcag
aaggagtacagcatctcggcagccgccatcgccatcttcagccttggcttcatcatcctg
ggcagcctctgtgtcctcctgtccctcgggaagaagagggactatctgctgcgacccgcg
tccatgttctatgcctttgcaggtctctgcatcctcgtctcggtggaggtcatgcggcag
tcggtgaagcgcatgattgacagtgaggacaccgtctggatcgagtactattactcctgg
tcctttgcctgcgcctgtgccgccttcatcctcctctttctcggcggtctcgccctcctg
ctgttctccctgcctcgaatgccccggaacccatgggagtcctgcatggatgctgagccc
gagcactaa

DBGET integrated database retrieval system