KEGG   Homo sapiens (human): 7862Help
Entry
7862              CDS       T01001                                 

Gene name
BRPF1, BR140, IDDDFP
Definition
(RefSeq) bromodomain and PHD finger containing 1
  KO
K11348  bromodomain and PHD finger-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7862 (BRPF1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     7862 (BRPF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 EPL1 zf-HC5HC2H Bromodomain PWWP PHD_2 PHD
Motif
Other DBs
NCBI-GeneID: 7862
NCBI-ProteinID: NP_004625
OMIM: 602410
HGNC: 14255
Ensembl: ENSG00000156983
Vega: OTTHUMG00000097033
Pharos: P55201(Tchem)
UniProt: P55201
Structure
PDB: 

Position
3p25.3
AA seq 1214 aa AA seqDB search
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgggggtggactttgatgtgaagactttctgccacaacttgcgggcgactaagccacca
tacgagtgcccggtggagacctgccgaaaggtctacaagagttacagtggtattgagtac
cacctgtaccactatgaccacgacaacccaccacccccacaacaaactccactccgcaag
cacaagaaaaaggggcgccagtcacgcccagccaacaagcagtcacccagcccctcagag
gtctcacagtcaccaggccgtgaggtgatgagctatgcacaggcccagcgcatggtggag
gtggacttgcatggccgcgtccaccgcatcagcatctttgacaacctggatgtggtgtca
gaggatgaggaagcccccgaggaggcccctgagaatggcagcaacaaggagaacactgag
acaccagctgctactcccaagtcaggcaaacataagaacaaggagaagcgcaaggactcc
aaccatcaccaccaccacaatgtttctgcgagcaccactcccaagctgccagaggtggtc
tatcgggagctggaacaggacacccctgatgccccaccccggccaacttcctattaccgg
tacatcgagaagtctgcagaggagctggacgaggaagtagagtatgacatggacgaggag
gactacatctggctggatatcatgaatgagcgtcggaagacagagggtgtaagtcccatc
ccgcaggagatctttgagtacctaatggaccgactggagaaggagtcgtactttgagagt
cataataaaggcgaccctaatgcgctagtggacgaggatgctgtttgctgtatctgcaat
gatggtgagtgccagaacagcaatgtcatcctcttctgtgacatgtgcaacctggccgtg
caccaggagtgctacggtgtcccctatatccctgagggccagtggctgtgccgccgttgc
ctgcagtcaccctctcgtgctgtggattgtgccctgtgccccaacaagggcggtgccttc
aagcagacagatgacgggcgctgggcccatgtggtgtgtgccttgtggatccctgaggtc
tgcttcgccaacacggtcttcctagagcctattgacagcattgagcacatcccaccagct
cgctggaagctcacctgctacatttgcaaacaacggggctcaggggcctgcatccagtgc
cacaaggccaactgttacacagctttccatgtgacatgcgcccagcaggctggcctttac
atgaagatggagcctgtgcgggagacaggcgccaacggcacctctttcagtgtccgcaag
acagcctactgcgacatccacacgcctccaggttcagcacgccgactgcctgccctgtcc
cacagcgagggtgaggaggatgaagatgaggaggaggatgagggtaagggctggagctca
gagaaagtcaagaaggccaaggccaagtcccggatcaaaatgaagaaggcacggaagatc
ctggcagagaagcgggcagcagcacctgtggtgtcagtgccctgcatcccaccacacagg
cttagtaaaatcaccaaccgcctgaccatccaaaggaagagccagttcatgcagaggctg
cacagctactggacactgaagcggcagtcacggaatggggtcccattgctacgtcgcctg
cagacacacctgcaatctcagaggaactgtgaccaagttgggagagattctgaggataag
aactgggcccttaaagaacagctcaagtcctggcagcggctccggcatgacttggagcga
gctcggctgctcgtggaattgatccgcaagcgggaaaaactcaaaagggagacgatcaag
gttcagcagattgccatggagatgcagctgactcctttcctcatcctccttcgcaaaacc
ttggagcagctccaagagaaggacacaggcaacatcttcagcgagccggtccctctgtct
gaggtacctgactacctagaccacatcaaaaagcccatggactttttcaccatgaagcag
aacttggaggcttaccgctacctgaattttgatgattttgaggaggacttcaacctcatc
gtcagcaactgcctcaagtataacgccaaggacaccatcttctaccgggcagcagtgcgg
cttcgtgagcagggtggtgctgtgctccgccaggcccggcgccaggcagaaaaaatgggc
attgactttgagacgggcatgcatatcccccacagcctggctggagatgaggccacacac
cacactgaagatgcagccgaggaagagcggctggtcttgctggagaaccagaagcacctg
ccagtggaagaacagctaaagctgcttctggagcggctggacgaagtgaatgccagcaag
cagagtgtgggccgctcacggcgtgcaaagatgatcaagaaagagatgacggcactgcgg
cggaagcttgcccatcagcgagagacgggacgtgatggccctgagcggcatggcccctcg
agccggggtagtctgacaccccacccggcagcctgtgacaaggatgggcagacagatagt
gcggcagaggagagcagcagccaggagacaagcaaaggcctgggtcccaacatgtcctca
acccccgcacatgaggtgggcaggagaacctcagttctgttctccaaaaagaacccgaag
acagctggaccgcccaagaggccgggccggccccccaaaaaccgggagagccagatgacc
cccagccacggaggcagtcctgtggggcccccccagctccccatcatgagttccctgcgt
cagcgcaagcggggtaggagcccccggcccagttcgagctcagacagcgacagtgataag
tccacagaagaccccccaatggacttaccagccaatggcttcagcggtggaaaccaacca
gtgaagaagagtttcttggtataccgtaatgactgcagccttccccggagcagctcagac
tctgagtccagcagcagtagcagtagcagcgctgcttcagaccggaccagcacaacgccc
tcaaaacaaggccggggcaaaccctccttctctcggggcactttcccagaggacagcagt
gaggatacctcaggcactgagaatgaggcctactccgtgggcactggccgcggcgtgggc
cacagcatggtaaggaagagtctgggccggggagctggctggctgtcagaggatgaggac
tccccgctggatgctctggacctcgtgtgggccaaatgccgaggctatccatcataccca
gctctgatcattgatccaaagatgccccgagaaggtatgttccaccatggggttcccatc
cctgtgcccccactggaggtgctgaaacttggggagcagatgacccaggaagcccgagag
catctctacctcgtcctcttctttgacaacaaacgaacctggcagtggctgcccaggacc
aagctggttcctctgggtgtgaaccaggacctagacaaggagaagatgctggagggccgc
aagtccaacatccgcaagtcagtacagatcgcctaccacagggctctgcagcaccgcagc
aaggtgcaaggcgagcagagcagtgagaccagcgatagtgattga

DBGET integrated database retrieval system