KEGG   Homo sapiens (human): 7873
Entry
7873              CDS       T01001                                 
Symbol
MANF, ARMET, ARP, DDDS
Name
(RefSeq) mesencephalic astrocyte derived neurotrophic factor
  KO
K22556  mesencephalic astrocyte-derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Disease
H02685  Developmental delay with neuropsychiatric disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7873 (MANF)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    7873 (MANF)
SSDB
Motif
Pfam: ARMET_N ARMET_C Redoxin CheZ TMCO5 RNF34L-like_3rd
Other DBs
NCBI-GeneID: 7873
NCBI-ProteinID: NP_006001
OMIM: 601916
HGNC: 15461
Ensembl: ENSG00000145050
Position
3:51385291..51389397
AA seq 182 aa
MRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENEL
IKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELK
YDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASART
DL
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaggaggatgtgggccacgcaggggctggcggtggcgctggctctgagcgtgctgccg
ggcagccgggcgctgcggccgggcgactgcgaagtttgtatttcttatctgggaagattt
taccaggacctcaaagacagagatgtcacattctcaccagccactattgaaaacgaactt
ataaagttctgccgggaagcaagaggcaaagagaatcggttgtgctactatatcggggcc
acagatgatgcagccaccaaaatcatcaatgaggtatcaaagcctctggcccaccacatc
cctgtggagaagatctgtgagaagcttaagaagaaggacagccagatatgtgagcttaag
tatgacaagcagatcgacctgagcacagtggacctgaagaagctccgagttaaagagctg
aagaagattctggatgactggggggagacatgcaaaggctgtgcagaaaagtctgactac
atccggaagataaatgaactgatgcctaaatatgcccccaaggcagccagtgcacggacc
gatttgtag

DBGET integrated database retrieval system