KEGG   Homo sapiens (human): 7873Help
Entry
7873              CDS       T01001                                 

Gene name
MANF, ARMET, ARP
Definition
(RefSeq) mesencephalic astrocyte derived neurotrophic factor
  KO
K22556  mesencephalic astrocyte-derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7873 (MANF)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    7873 (MANF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Armet CheZ Epsilon_antitox
Motif
Other DBs
NCBI-GeneID: 7873
NCBI-ProteinID: NP_006001
OMIM: 601916
HGNC: 15461
Ensembl: ENSG00000145050
Vega: OTTHUMG00000156897
Pharos: P55145(Tbio)
UniProt: P55145 A8K878
Structure
PDB: 

Position
3p21.2
AA seq 182 aa AA seqDB search
MRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENEL
IKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELK
YDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASART
DL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggatgtgggccacgcaggggctggcggtggcgctggctctgagcgtgctgccg
ggcagccgggcgctgcggccgggcgactgcgaagtttgtatttcttatctgggaagattt
taccaggacctcaaagacagagatgtcacattctcaccagccactattgaaaacgaactt
ataaagttctgccgggaagcaagaggcaaagagaatcggttgtgctactatatcggggcc
acagatgatgcagccaccaaaatcatcaatgaggtatcaaagcctctggcccaccacatc
cctgtggagaagatctgtgagaagcttaagaagaaggacagccagatatgtgagcttaag
tatgacaagcagatcgacctgagcacagtggacctgaagaagctccgagttaaagagctg
aagaagattctggatgactggggggagacatgcaaaggctgtgcagaaaagtctgactac
atccggaagataaatgaactgatgcctaaatatgcccccaaggcagccagtgcacggacc
gatttgtag

DBGET integrated database retrieval system