KEGG   Homo sapiens (human): 7874Help
Entry
7874              CDS       T01001                                 

Gene name
USP7, HAUSP, TEF1
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06165  Epstein-Barr virus (EBV)
  Element
N00223  EBV EBNA1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    7874 (USP7)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    7874 (USP7)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    7874 (USP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    7874 (USP7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7874 (USP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     7874 (USP7)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   7874 (USP7)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    7874 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 7874
NCBI-ProteinID: NP_003461
OMIM: 602519
HGNC: 12630
Ensembl: ENSG00000187555
Vega: OTTHUMG00000176903
Pharos: Q93009(Tchem)
UniProt: Q93009 Q6U8A4
Structure
PDB: 

Position
16p13.2
AA seq 1102 aa AA seqDB search
MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNTAEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI
FESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
SLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccagcagcagcagcagcagcagaaagcgggcgagcagcagttgagcgagccc
gaggacatggagatggaagcgggagatacagatgacccaccaagaattactcagaaccct
gtgatcaatgggaatgtggccctgagtgatggacacaacaccgcggaggaggacatggag
gatgacaccagttggcgctccgaggcaacctttcagttcactgtggagcgcttcagcaga
ctgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagattatg
gtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctccag
tgcaatgctgaatctgattccacgtcatggtcttgccatgcacaagcagtgctgaagata
ataaattacagagatgatgaaaagtcgttcagtcgtcgtattagtcatttgttcttccat
aaagaaaatgattggggattttccaattttatggcctggagtgaagtgaccgatcctgag
aaaggatttatagatgatgacaaagttacctttgaagtctttgtacaggcggatgctccc
catggagttgcgtgggattcaaagaagcacacaggctacgtcggcttaaagaatcaggga
gcgacttgttacatgaacagcctgctacagacgttatttttcacgaatcagctacgaaag
gctgtgtacatgatgccaaccgagggggatgattcgtctaaaagcgtccctttagcatta
caaagagtgttctatgaattacagcatagtgataaacctgtaggaacaaaaaagttaaca
aagtcatttgggtgggaaactttagatagcttcatgcaacatgatgttcaggagctttgt
cgagtgttgctcgataatgtggaaaataagatgaaaggcacctgtgtagagggcaccata
cccaaattattccgcggcaaaatggtgtcctatatccagtgtaaagaagtagactatcgg
tctgatagaagagaagattattatgatatccagctaagtatcaaaggaaagaaaaatata
tttgaatcatttgtggattatgtggcagtagaacagctcgatggggacaataaatacgac
gctggggaacatggcttacaggaagcagagaaaggtgtgaaattcctaacattgccacca
gtgttacatctacaactgatgagatttatgtatgaccctcagacggaccaaaatatcaag
atcaatgataggtttgaattcccagagcagttaccacttgatgaatttttgcaaaaaaca
gatcctaaggaccctgcaaattatattcttcatgcagtcctggttcatagtggagataat
catggtggacattatgtggtttatctaaaccccaaaggggatggcaaatggtgtaaattt
gatgacgacgtggtgtcaaggtgtactaaagaggaagcaattgagcacaattatgggggt
cacgatgacgacctgtctgttcgacactgcactaatgcttacatgttagtctacatcagg
gaatcaaaactgagtgaagttttacaggcggtcaccgaccatgatattcctcagcagttg
gtggagcgattacaagaagagaaaaggatcgaggctcagaagcggaaggagcggcaggaa
gcccatctctatatgcaagtgcagatagtcgcagaggaccagttttgtggccaccaaggg
aatgacatgtacgatgaagaaaaagtgaaatacactgtgttcaaagtattgaagaactcc
tcgcttgctgagtttgttcagagcctctctcagaccatgggatttccacaagatcaaatt
cgattgtggcccatgcaagcaaggagtaatggaacaaaacgaccagcaatgttagataat
gaagccgacggcaataaaacaatgattgagctcagtgataatgaaaacccttggacaata
ttcctggaaacagttgatcccgagctggctgctagtggagcgaccttacccaagtttgat
aaagatcatgatgtaatgttatttttgaagatgtatgatcccaaaacgcggagcttgaat
tactgtgggcatatctacacaccaatatcctgtaaaatacgtgacttgctcccagttatg
tgtgacagagcaggatttattcaagatactagccttatcctctatgaggaagttaaaccg
aatttaacagagagaattcaggactatgacgtgtctcttgataaagcccttgatgaacta
atggatggtgacatcatagtatttcagaaggatgaccctgaaaatgataacagtgaatta
cccaccgcaaaggagtatttccgagatctctaccaccgcgttgatgtcattttctgtgat
aaaacaatccctaatgatcctggatttgtggttacgttatcaaatagaatgaattatttt
caggttgcaaagacagttgcacagaggctcaacacagatccaatgttgctgcagtttttc
aagtctcaaggttatagggatggcccaggtaatcctcttagacataattatgaaggtact
ttaagagatcttctacagttcttcaagcctagacaacctaagaaactttactatcagcag
cttaagatgaaaatcacagactttgagaacaggcgaagttttaaatgtatatggttaaac
agccaatttagggaagaggaaataacactatatccagacaagcatgggtgtgtccgggac
ctgttagaagaatgtaaaaaggccgtggagcttggggagaaagcatcagggaaacttagg
ctgctagaaattgtaagctacaaaatcattggtgttcatcaagaagatgaactattagaa
tgtttatctcctgcaacgagccggacgtttcgaatagaggaaatccctttggaccaggtg
gacatagacaaagagaatgagatgcttgtcacagtggcgcatttccacaaagaggtcttc
ggaacgttcggaatcccgtttttgctgaggatacaccagggcgagcattttcgagaagtg
atgaagcgaatccagagcctgctggacatccaggagaaggagtttgagaagtttaaattt
gcaattgtaatgatgggccgacaccagtacataaatgaagacgagtatgaagtaaatttg
aaagactttgagccacagcccggtaatatgtctcatcctcggccttggctagggctcgac
cacttcaacaaagccccaaagaggagtcgctacacttaccttgaaaaggccattaaaatc
cataactga

DBGET integrated database retrieval system