KEGG   Homo sapiens (human): 788Help
Entry
788               CDS       T01001                                 

Gene name
SLC25A20, CAC, CACT
Definition
(RefSeq) solute carrier family 25 member 20
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01400  Secondary hyperammonemia
H01983  Carnitine-acylcarnitine translocase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    788 (SLC25A20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    788 (SLC25A20)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   788 (SLC25A20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 788
NCBI-ProteinID: NP_000378
OMIM: 613698
HGNC: 1421
Ensembl: ENSG00000178537
Vega: OTTHUMG00000133538
Pharos: O43772(Tbio)
UniProt: O43772
Position
3p21.31
AA seq 301 aa AA seqDB search
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFR
KTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLS
GVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDV
PASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTA
PPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPN
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccagccaaaacccatcagcccgctcaagaacctgctggccggcggctttggc
ggcgtgtgcctggtgttcgtcggtcaccctctggacacggtcaaggtccgactgcagaca
cagccaccgagtttgcctggacaacctcccatgtactctgggacctttgactgtttccgg
aagactctttttagagagggcatcacggggctatatcggggaatggctgcccctatcatc
ggggtcactcccatgtttgccgtgtgcttctttgggtttggtttggggaagaaactacaa
cagaaacacccagaagatgtgctcagctatccccagctttttgcagctgggatgttatct
ggcgtattcaccacaggaatcatgactcctggagaacggatcaagtgcttattacagatt
caggcttcttcaggagaaagcaagtacactggtaccttggactgtgcaaagaagctgtac
caggagtttgggatccgaggcatctacaaagggactgtgcttacccttatgcgagatgtc
ccagctagtggaatgtatttcatgacatatgaatggctgaaaaatatcttcactccggag
ggaaagagggtcagtgagctcagtgcccctcggatcttggtggctgggggcattgcaggg
atcttcaactgggctgtggcaatccccccagatgtgctcaagtctcgattccagactgca
cctcctgggaaatatcctaatggtttcagagatgtgctgagggagctgatccgggatgaa
ggagtcacatccttgtacaaagggttcaatgcagtgatgatccgagccttcccagccaat
gcggcctgtttccttggctttgaagttgccatgaagttccttaattgggccacccccaac
ttgtga

DBGET integrated database retrieval system