KEGG   Homo sapiens (human): 78986
Entry
78986             CDS       T01001                                 
Symbol
DUSP26, DSP-4, DUSP24, LDP-4, LDP4, MKP-8, MKP8, NATA1, NEAP, SKRP3
Name
(RefSeq) dual specificity phosphatase 26
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    78986 (DUSP26)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     78986 (DUSP26)
    3.1.3.48  protein-tyrosine-phosphatase
     78986 (DUSP26)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    78986 (DUSP26)
SSDB
Motif
Pfam: DSPc Tc-R-P PTP-SAK Y_phosphatase Init_tRNA_PT PTP-NADK
Other DBs
NCBI-GeneID: 78986
NCBI-ProteinID: NP_001292044
OMIM: 618368
HGNC: 28161
Ensembl: ENSG00000133878
UniProt: Q9BV47
Position
8:complement(33591330..33600023)
AA seq 211 aa
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtgccctggtaactggctttgggcttctatgacttttatggcccgcttctcccggagt
agctcaaggtctcctgttcgaactcgagggaccctggaggagatgccaaccgttcaacat
cctttcctcaatgtcttcgagttggagcggctcctctacacaggcaagacagcctgtaac
catgccgacgaggtctggccaggcctctatctcggagaccaggacatggctaacaaccgc
cgggagcttcgccgcctgggcatcacgcacgtcctcaatgcctcacacagccggtggcga
ggcacgcccgaggcctatgaggggctgggcatccgctacctgggtgttgaggcccacgac
tcgccagcctttgacatgagcatccacttccagacggctgccgacttcatccaccgggcg
ctgagccagccaggagggaagatcctggtgcattgtgctgtgggcgtgagccgatccgcc
accctggtactggcctacctcatgctgtaccaccaccttaccctcgtggaggccatcaag
aaagtcaaagaccaccgaggcatcatccccaaccggggcttcctgaggcagctcctggcc
ctggaccgcaggctgcggcagggtctggaagcatga

DBGET integrated database retrieval system