KEGG   Homo sapiens (human): 78990
Entry
78990             CDS       T01001                                 

Gene name
OTUB2, C14orf137, OTB2, OTU2
Definition
(RefSeq) OTU deubiquitinase, ubiquitin aldehyde binding 2
  KO
K09603  ubiquitin thioesterase protein OTUB2 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    78990 (OTUB2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    78990 (OTUB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     78990 (OTUB2)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C65
   78990 (OTUB2)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    78990 (OTUB2)
SSDB
Motif
Pfam: Peptidase_C65 OTU ETC_C1_NDUFA5 Peptidase_C101 OST-HTH
Other DBs
NCBI-GeneID: 78990
NCBI-ProteinID: NP_075601
OMIM: 608338
HGNC: 20351
Ensembl: ENSG00000089723
Vega: OTTHUMG00000171300
Pharos: Q96DC9(Tbio)
UniProt: Q96DC9
Structure
PDB: 
4FJV 1TFF

Position
14q32.12
AA seq 234 aa
MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSY
LESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLK
VFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQI
TALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagtgaaacatctttcaacctaatatcagaaaaatgtgacattctatccattcttcgg
gaccatcctgaaaacaggatttaccggaggaaaatcgaggaactcagcaaaaggttcacc
gccatccgcaagaccaaaggggatgggaactgcttctacagggccttgggctattcctac
ctggagtccctgctggggaagagcagggagatcttcaagttcaaagaacgcgtactgcag
accccaaatgaccttctggctgctggctttgaggagcacaagttcagaaacttcttcaat
gctttttacagtgtggtggaactggtagagaaggatggctcagtgtccagcctgctgaag
gtgttcaacgaccagagtgcctcggaccacatcgtgcagttcctgcgcctgctcacgtcg
gccttcatcaggaaccgagcagacttcttccggcacttcattgatgaggagatggacatc
aaagacttctgcactcacgaagtagagcccatggccacggagtgtgaccacatccagatc
acggcgttgtcgcaggccctgagcattgccctgcaagtggagtacgtggacgagatggat
accgccctgaaccaccacgtgttccctgaggccgccaccccttccgtttacctgctctat
aaaacatcccactacaacatcctttatgcagccgataaacattga

DBGET integrated database retrieval system