KEGG   Homo sapiens (human): 78995
Entry
78995             CDS       T01001                                 
Symbol
HROB, C17orf53, MCM8IP
Name
(RefSeq) homologous recombination factor with OB-fold
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HROB
Other DBs
NCBI-GeneID: 78995
NCBI-ProteinID: NP_076937
OMIM: 618611
HGNC: 28460
Ensembl: ENSG00000125319
Pharos: Q8N3J3(Tdark)
UniProt: Q8N3J3
Position
17:44141930..44162476
AA seq 647 aa
MACSLQKLFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRL
LLLHPTAPSEALGLPDLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVT
EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEPGMELECGVSS
EAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPR
PPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQPLQAARGTIQSSPQNRFPCQP
FQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSSIGSPVGTPKGPQ
GALQTPIVTNHLVQLVTAASRTPQQPTHPSTRAKTRRFPGPAGILPHQQSGRSLEDIMVS
APQTPTHGALAKFQTEIVASSQASVEEDFGRGPWLTMKSTLGLDERDPSCFLCTYSIVMV
LRKQAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELK
PGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDV
AAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPEDFFCGTSS
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggcgtgcagtttgcagaagctgtttgctgtggaagaggagtttgaagatgaggatttc
ttgtctgctgtggaggatgcagagaaccggtttactggctcactgcctgtgaatgctggg
cgcctgagacctgtctcttctaggccacaggagactgtgcaggcacagtcctccaggctg
ctgctgttacaccccactgctccctcagaggctttgggcctgccagacttggacctctgc
ctccctgcctccagcacgcccagtgctgacagccgtccatcatgcataggagcagctccc
ctaaggcctgtctctacttccagcagctggattggcaatcagagaagagtgacagtgaca
gaagtgctcagagagacagcaagacctcagtcctcagccttacaccccctactcaccttt
gagagccaacagcagcaagttggtggctttgaggggcctgaacaagacgaatttgataaa
gtcctggcaagcatggagttggaggagcctggcatggagctggaatgtggagtcagcagt
gaggccataccaatcctgcctgcccagcagcgggagggttcagtattggctaaaaaagcc
cgggtagttgatctgagtggatcttgccagaaggggcctgtgcctgccatccacaaagcg
ggtatcatgtccgcccaggatgagtctctagatcctgtcatccaatgtaggactccacga
ccccccttgagacctggtgctgtgggtcaccttcctgttccaactgccttaacagttccc
actcagcaactccactgggaagtctgtccgcaacgctcccctgttcaagcacttcagcct
ctccaagctgctagagggaccattcagagcagccctcaaaatcgtttcccttgtcagcca
ttccagtctccaagttcctggttaagtggcaaagctcatttacccagacctcgaactccc
aactcaagctgttctactccctcaaggactagctctggattatttcctcggataccctta
caaccgcaagctccagtgtcttccattgggtctcctgttggtaccccaaaaggtccccag
ggagctctgcagacacccatagtcaccaaccacctggtgcagctagtcactgctgccagc
cggacaccccagcagcccacccatccctccacccgagccaaaactcgccgtttccctggc
ccagctgggatcctgcctcaccagcagagtgggagaagtctggaggacatcatggtttcc
gcgccccaaactccaacccatggtgctctggctaaattccagacagagattgttgctagt
tcccaggcatctgtggaggaggattttgggcgagggccctggctgaccatgaaatccacg
ctaggcctggatgagagagaccctagctgcttcctctgtacctacagcattgtcatggtg
ctgcgcaagcaggcagccctgaagcagcttcctaggaacaaggtccccaacatggcggtg
atgatcaagtccctgactcggagcacaatggacgccagtgtggttttcaaggaccccacg
ggagagatgcaggggacggtgcacaggttgctgctggagacgtgccagaatgagctgaag
cctggctcagtgctgctgctgaagcagattggagtgttttctccttcacttcgaaatcac
tacctcaacgtgacacccaacaacctggtccatatttacagcccggattctggggatggg
agcttcctcaagccatctcagcccttccccaaggattcagggagcttccagcatgatgtg
gctgcaaagcccgaggaaggcttcagaacagcacagaacctagaggcagaggcgtcccct
gaggaagaactcccagaagcagatgacctggatggactcctgagtgagcttcctgaagac
ttcttctgtgggaccagtagttga

DBGET integrated database retrieval system