KEGG   Homo sapiens (human): 78997
Entry
78997             CDS       T01001                                 

Gene name
GDAP1L1, dJ881L22.1, dJ995J12.1.1
Definition
(RefSeq) ganglioside induced differentiation associated protein 1 like 1
  KO
K22077  ganglioside-induced differentiation-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    78997 (GDAP1L1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    78997 (GDAP1L1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Tom37
Other DBs
NCBI-GeneID: 78997
NCBI-ProteinID: NP_076939
HGNC: 4213
Ensembl: ENSG00000124194
Vega: OTTHUMG00000032530
Pharos: Q96MZ0(Tdark)
UniProt: Q96MZ0
Position
20q13.12
AA seq 367 aa
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
YLKKKYI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcgacccccaacaatctgacccccaccaactgcagctggtggcccatctccgcgctg
gagagcgatgcggccaagccagcggaggcccccgacgctcccgaggcggccagccccgcc
cattggcccagggagagcctggttctgtaccactggacccagtccttcagctcgcagaag
gtgcggctggtgatcgccgagaagggcctggtgtgcgaggagcgggacgtgagcctgcca
cagagcgagcacaaggagccctggttcatgcggctcaacctgggcgaggaggtgcccgtc
atcatccaccgcgacaacatcatcagtgactatgaccagatcattgactatgtggagcgc
accttcacaggagagcacgtggtggccctgatgcccgaggtgggcagcctgcagcacgca
cgggtgctgcagtaccgggagctgctggacgcactgcccatggatgcctacacgcatggc
tgcatcctgcatcccgagctcaccaccgactccatgatccccaagtacgccacggccgag
atccgcagacatttagccaatgccaccacggacctcatgaaactggaccatgaagaggag
ccccagctctccgagccctacctttctaaacaaaagaagctcatggccaagatcttggag
catgatgatgtgagctacctgaagaagatcctcggggaactggccatggtgctggaccag
attgaggcggagctggagaagaggaagctggagaacgaggggcagaaatgcgagctgtgg
ctctgtggctgtgccttcaccctcgctgatgtcctcctgggagccaccctgcaccgcctc
aagttcctgggactgtccaagaaatactgggaagatggcagccggcccaacctgcagtcc
ttctttgagagggtccagagacgctttgccttccggaaagtcctgggtgacatccacacc
accctgctgtcggccgtcatccccaatgctttccggctggtcaagaggaaacccccatcc
ttcttcggggcgtccttcctcatgggctccctgggtgggatgggctactttgcctactgg
tacctcaagaaaaaatacatctag

DBGET integrated database retrieval system