KEGG   Homo sapiens (human): 790Help
Entry
790               CDS       T01001                                 

Gene name
CAD, CDG1Z, EIEE50, GATD4
Definition
(RefSeq) carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
  KO
K11540  carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    790 (CAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    790 (CAD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    790 (CAD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     790 (CAD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     790 (CAD)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     790 (CAD)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   790 (CAD)
 Metallo peptidases
  Family M38: beta-aspartyl dipeptidase family
   790 (CAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 CPSase_sm_chain OTCace_N GATase CPSase_L_D3 OTCace ATP-grasp Dala_Dala_lig_C MGS ATPgrasp_Ter Amidohydro_1 ATP-grasp_3 Peptidase_C26 GARS_A
Motif
Other DBs
NCBI-GeneID: 790
NCBI-ProteinID: NP_004332
OMIM: 114010
HGNC: 1424
Ensembl: ENSG00000084774
Vega: OTTHUMG00000097070
Pharos: P27708(Tchem)
UniProt: P27708
Structure
PDB: 

Position
2p23.3
AA seq 2225 aa AA seqDB search
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM
KRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLN
ETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVI
DCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASD
PGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHS
LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctagtgttggaggacgggtcggtcctgcggggccagccctttggggccgcc
gtgtcgactgccggggaagtggtgtttcaaaccggcatggtcggctaccccgaggccctc
actgatccctcctacaaggcacagatcttagtgctcacctatcctctgatcggcaactat
ggcatccccccagatgaaatggatgagttcggtctctgcaagtggtttgaatcctcgggc
atccacgtagcagcactggtagtgggagagtgctgtcctactcccagccactggagtgcc
acccgcaccctgcatgagtggctgcagcagcatggcatccctggcttgcaaggagtagac
actcgggagctgaccaagaagttgcgggaacaggggtctctgctggggaagctggtccag
aatggaacagaaccttcatccctgccattcttggaccccaatgcccgccccctggtacca
gaggtctccattaagactccacgggtattcaatacagggggtgcccctcggatccttgct
ttggactgtggcctcaagtataatcagatccgatgcctctgccagcgtggggctgaggtc
actgtggtaccctgggaccatgcactagacagccaagagtatgagggtctcttcttaagt
aatgggcctggtgaccctgcctcctatcccagtgtcgtatccacactgagccgtgtttta
tctgagcctaatccccgacctgtctttgggatctgcctgggacaccagctattggcctta
gccattggggccaagacttacaagatgagatatgggaaccgaggccataaccagccctgc
ttgttggtgggctctgggcgctgctttctgacatcccagaaccatgggtttgctgtggag
acagactcactgccagcagactgggctcctctcttcaccaacgccaatgatggttccaat
gaaggcattgtgcacaacagcttgcctttcttcagtgtccagtttcacccagagcaccaa
gctggcccttcagatatggaactgcttttcgatatctttctggaaactgtgaaagaggcc
acagctgggaaccctgggggccagacagttagagagcggctgactgagcgcctctgtccc
cctgggattcccactcccggctctggacttccaccaccacgaaaggttctgatcctgggc
tcagggggcctctccattggccaagctggagaatttgactactcgggctctcaggcaatt
aaggccctgaaggaggaaaacatccagacgttgctgatcaaccccaatattgccacagtg
cagacctcccaggggctggccgacaaggtctattttcttcccataacacctcattatgta
acccaggtgatacgtaatgaacgccccgatggtgtgttactgacttttgggggccagact
gctctgaactgtggtgtggagctgaccaaggccggggtgctggctcggtatggggtccgg
gtcctgggcacaccagtggagaccattgagctgaccgaggatcgacgggcctttgctgcc
agaatggcagagatcggagagcatgtggccccgagcgaggcagcaaattctcttgaacag
gcccaggcagccgctgaacggctggggtaccctgtgctagtgcgtgcagcctttgccctg
ggtggcctgggctctggctttgcctctaacagggaggagctctctgctctcgtggcccca
gcttttgcccataccagccaagtgctagtagacaagtctctgaagggatggaaggagatt
gagtacgaggtggtgagagacgcctatggcaactgtgtcacggtgtgtaacatggagaac
ttggacccactgggcatccacactggtgagtccatagtggtggcccctagccagacactg
aatgacagggagtatcagctcctgaggcagacagctatcaaggtgacccagcacctggga
attgttggggagtgcaatgtgcagtatgccttgaaccctgagtctgagcagtattacatc
attgaagtgaatgccaggctctctcgcagctctgccctggccagtaaggccacaggttat
ccactggcttatgtggcagccaagctagcattgggcatccctttgcctgagctcaggaac
tctgtgacagggggtacagcagcctttgaacccagcgtggattattgtgtggtgaagatt
cctcgatgggaccttagcaagttcctgcgagtcagcacaaagattgggagctgcatgaag
agcgttggtgaagtcatgggcattgggcgttcatttgaggaggccttccagaaggccctg
cgcatggtggatgagaactgtgtgggctttgatcacacagtgaaaccagtcagcgatatg
gagttggagactccaacagataagcggatttttgtggtggcagctgctttgtgggctggt
tattcagtggaccgcctgtatgagctcacacgcatcgaccgctggttcctgcaccgaatg
aagcgtatcatcgcacatgcccagctgctagaacaacaccgtggacagcctttgccgcca
gacctgctgcaacaggccaagtgtcttggcttctcagacaaacagattgcccttgcagtt
ctgagcacagagctggctgttcgcaagctgcgtcaggaactggggatctgtccagcagtg
aaacagattgacacagttgcagctgagtggccagcccagacaaattacctatacctaacg
tattggggcaccacccatgacctcacctttcgaacacctcatgtcctagtccttggctct
ggcgtctaccgtattggctctagcgttgaatttgactggtgtgctgtaggctgcatccag
cagctccgaaagatgggatataagaccatcatggtgaactataacccagagacagtcagc
accgactatgacatgtgtgatcgactctactttgatgagatctcttttgaggtggtgatg
gacatctatgagctcgagaaccctgaaggtgtgatcctatccatgggtggacagctgccc
aacaacatggccatggcgttgcatcggcagcagtgccgggtgctgggcacctcccctgaa
gccattgactcggctgagaaccgtttcaagttttcccggctccttgacaccattggtatc
agccagcctcagtggagggagctcagtgacctcgagtctgctcgccaattctgccagacc
gtggggtacccctgtgtggtgcgcccctcctatgtgctgagcggtgctgctatgaatgtg
gcctacacggatggagacctggagcgcttcctgagcagcgcagcagccgtctccaaagag
catcccgtggtcatctccaagttcatccaggaggctaaggagattgacgtggatgccgtg
gcctctgatggtgtggtggcagccatcgccatctctgagcatgtggagaatgcaggtgtg
cattcaggtgatgcgacgctggtgacccccccacaagatatcactgccaaaaccctggag
cggatcaaagccattgtgcatgctgtgggccaggagctacaggtcacaggacccttcaat
ctgcagctcattgccaaggatgaccagctgaaagttattgaatgcaacgtacgtgtctct
cgctccttccccttcgtttccaagacactgggtgtggacctagtagccttggccacgcgg
gtcatcatgggggaagaagtggaacctgtggggctaatgactggttctggagtcgtggga
gtaaaggtgcctcagttctccttctcccgcttggcgggtgctgacgtggtgttgggtgtg
gaaatgaccagtactggggaggtggccggctttggggagagccgctgtgaggcatacctc
aaggccatgctaagcactggctttaagatccccaagaagaatatcctgctgaccattggc
agctataagaacaaaagcgagctgctcccaactgtgcggctactggagagcctgggctac
agcctctatgccagtctcggcacagctgacttctacactgagcatggcgtcaaggtaaca
gctgtggactggcactttgaggaggctgtggatggtgagtgcccaccacagcggagcatc
ctggagcagctagctgagaaaaactttgagctggtgattaacctgtcaatgcgtggagct
gggggccggcgtctctcttcctttgtcaccaagggctaccgcacccgacgcttggccgct
gacttctccgtgcccctaatcatcgatatcaagtgcaccaaactctttgtggaggcccta
ggccagatcgggccagcccctcctttgaaggtgcatgttgactgtatgacctcccaaaag
cttgtgcgactgccgggattgattgatgtccatgtgcacctgcgggaaccaggtgggaca
cataaggaggactttgcttcaggcacagccgctgccctggctgggggtatcaccatggtg
tgtgccatgcctaatacccggccccccatcattgacgcccctgctctggccctggcccag
aagctggcagaggctggcgcccggtgcgactttgcgctattccttggggcctcgtctgaa
aatgcaggaaccttgggcaccgtggccgggtctgcagccgggctgaagctttacctcaat
gagaccttctctgagctgcggctggacagcgtggtccagtggatggagcatttcgagaca
tggccctcccacctccccattgtggctcacgcagagcagcaaaccgtggctgctgtcctc
atggtggctcagctcactcagcgctcagtgcacatatgtcacgtggcacggaaggaggag
atcctgctaattaaagctgcaaaggcacggggcttgccagtgacctgcgaggtggctccc
caccacctgttcctaagccatgatgacctggagcgcctggggcctgggaagggggaggtc
cggcctgagcttggctcccgccaggatgtggaagccctgtgggagaacatggctgtcatc
gactgctttgcctcagaccatgctccccataccttggaggagaagtgtgggtccaggccc
ccacctgggttcccagggttagagaccatgctgccactactcctgacggctgtaagcgag
ggccggctcagcctggacgacctgctgcagcgattgcaccacaatcctcggcgcatcttt
cacctgcccccgcaggaggacacctatgtggaggtggatctggagcatgagtggacaatt
cccagccacatgcccttctccaaggcccactggacaccttttgaagggcagaaagtgaag
ggcaccgtccgccgtgtggtcctgcgaggggaggttgcctatatcgatgggcaggttctg
gtacccccgggctatggacaggatgtacggaagtggccacagggggctgttcctcagctc
ccaccctcagcccctgccactagtgagatgaccacgacacctgaaagaccccgccgtggc
atcccagggcttcctgatggccgcttccatctgccgccccgaatccatcgagcctccgac
ccaggtttgccagctgaggagccaaaggagaagtcctctcggaaggtagccgagccagag
ctgatgggaacccctgatggcacctgctaccctccaccaccagtaccgagacaggcatct
ccccagaacctggggacccctggcttgctgcacccccagacctcacccctgctgcactca
ttagtgggccaacatatcctgtccgtccagcagttcaccaaggatcagatgtctcacctg
ttcaatgtggcacacacactgcgtatgatggtgcagaaggagcggagcctcgacatcctg
aaggggaaggtcatggcctccatgttctatgaagtgagcacacggaccagcagctccttt
gcagcagccatggcccggctgggaggtgctgtgctcagcttctcggaagccacatcgtcc
gtccagaagggcgaatccctggctgactccgtgcagaccatgagctgctatgccgacgtc
gtcgtgctccggcacccccagcctggagcagtggagctggccgccaagcactgccggagg
ccagtgatcaatgctggggatggggtcggagagcaccccacccaggccctgctggacatc
ttcaccatccgtgaggagctgggaactgtcaatggcatgacgatcacgatggtgggtgac
ctgaagcacggacgcacagtacattccctggcctgcctgctcacccagtatcgtgtcagc
ctgcgctacgtggcacctcccagcctgcgcatgccacccactgtgcgggccttcgtggcc
tcccgcggcaccaagcaggaggaattcgagagcattgaggaggcgctgcctgacactgat
gtgctctacatgactcgaatccagaaggaacgatttggctctacccaggagtacgaagct
tgctttggtcagttcatcctcactccccacatcatgacccgggccaagaagaagatggtg
gtgatgcacccgatgccccgtgtcaacgagataagcgtggaagtggactcggatccccgc
gcagcctacttccgccaggctgagaacggcatgtacatccgcatggctctgttagccacc
gtgctgggccgtttctag

DBGET integrated database retrieval system