KEGG   Homo sapiens (human): 79008Help
Entry
79008             CDS       T01001                                 

Gene name
SLX1B, GIYD2
Definition
(RefSeq) SLX1 homolog B, structure-specific endonuclease subunit
  KO
K15078  structure-specific endonuclease subunit SLX1 [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    79008 (SLX1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79008 (SLX1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     79008 (SLX1B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     79008 (SLX1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIY-YIG FANCL_C
Motif
Other DBs
NCBI-GeneID: 79008
NCBI-ProteinID: NP_076949
OMIM: 615823
HGNC: 28748
Ensembl: ENSG00000181625
Vega: OTTHUMG00000132110
Pharos: Q9BQ83(Tbio)
UniProt: Q9BQ83
Position
16p11.2
AA seq 275 aa AA seqDB search
MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGR
GPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRA
PPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQG
DPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEK
SLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgcgggggtcgcggcgaggccagggcgctttttcggcgtctacctgctctac
tgcctgaacccccggtaccggggccgcgtctacgtggggttcactgtcaacactgctcgt
cgggtccagcagcacaatgggggccgcaaaaaaggcggggcctggcggaccagcgggcga
gggccctgggagatggtgctcgtcgtgcacggcttcccgtcctccgtggccgcccttcgg
tttgagtgggcttggcagcacccgcacgcctcgcgccgcctggcgcacgtggggcctcgc
ctgcgaggagagacagccttcgctttccacctgcgcgtgctggcgcacatgctgcgcgca
ccgccctgggctcgcctcccgctcacgctgcgctgggtgcgcccagacctccgccaggac
ctctgcctcccgccgccgccgcacgtgcctctggccttcgggcctccaccgccccaggcc
ccggccccaaggcgccgcgcaggtccctttgatgacgcggagcctgagccagaccagggg
gatccaggggcctgctgctccctgtgcgcccagaccatccaggatgaagaggggcccttg
tgttgcccccaccctggctgcctgctaagggcccatgtgatctgcctggcagaggagttt
cttcaggaagaaccagggcagcttctgcccctagagggccaatgcccttgctgtgagaag
tcactgctttggggagacctgatctggctgtgccagatggacactgagaaagaagtagaa
gactcagaattagaagaggcacactggacagacctgctggagacctga

DBGET integrated database retrieval system