KEGG   Homo sapiens (human): 79012Help
Entry
79012             CDS       T01001                                 

Gene name
CAMKV, 1G5, VACAMKL
Definition
(RefSeq) CaM kinase like vesicle associated
  KO
K08812  CaM kinase-like vesicle-associated [EC:2.7.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    79012 (CAMKV)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     79012 (CAMKV)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   79012 (CAMKV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 79012
NCBI-ProteinID: NP_076951
OMIM: 614993
HGNC: 28788
Ensembl: ENSG00000164076
Vega: OTTHUMG00000158288
Pharos: Q8NCB2(Tbio)
UniProt: Q8NCB2 A0A140VKD5
Position
3p21.31
AA seq 501 aa AA seqDB search
MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDG
RKVRKAAKNEIGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSER
DTSNVVRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEP
CGTPEYLAPEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKI
LAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGV
CAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGAAGGATAAAAS
GATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP
ATDRSATPATDGRATPATEESTVPTTQSSAMLATKAAATPEPAMAQPDSTAPEGATGQAP
PSSKGEEAAGYAQESQREEAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgggtgtgtgactctgggcgacaagaagaactataaccagccatcggaggtg
actgacagatatgatttgggacaggtcatcaagactgaggagttttgtgaaatcttccgg
gccaaggacaagacgacaggcaagctgcacacctgcaagaagttccagaagcgggacggc
cgcaaggtgcggaaagctgccaagaacgagataggcatcctcaagatggtgaagcatccc
aacatcctacagctggtggatgtgtttgtgacccgcaaggagtactttatcttcctggag
ctggccacggggagggaggtgtttgactggatcctggaccagggctactactcggagcga
gacacaagcaacgtggtacggcaagtcctggaggccgtggcctatttgcactcactcaag
atcgtgcacaggaatctcaagctggagaacctggtttactacaaccggctgaagaactcg
aagattgtcatcagtgacttccatctggctaagctagaaaatggcctcatcaaggagccc
tgtgggacccccgagtatctggccccagaggtggtaggccggcagcggtatggacgccct
gtggactgctgggccattggagtcatcatgtacatcctgctttcaggcaatccacctttc
tatgaggaggtggaagaagatgattatgagaaccatgataagaatctcttccgcaagatc
ctggctggtgactatgagtttgactctccatattgggatgatatttcgcaggcagccaaa
gacctggtcacaaggctgatggaggtggagcaagaccagcggatcactgcagaagaggcc
atctcccatgagtggatttctggcaatgctgcttctgataagaacatcaaggatggtgtc
tgtgcccagattgaaaagaactttgccagggccaagtggaagaaggctgtccgagtgacc
accctcatgaaacggctccgggcaccagagcagtccagcacggctgcagcccagtcggcc
tcagccacagacactgccacccccggggctgcaggtggggccacagctgcagctgcgagt
ggagctacctcagcccctgagggtgatgctgctcgtgctgcaaagagtgataatgtggcc
cccgcagaccgtagtgccaccccagccacagatggaagtgccaccccagccactgatggc
agtgtcaccccagccaccgatggaagcatcactccagccactgatgggagtgtcacccca
gccactgacaggagcgctactccagccactgatgggagagccacaccagccacagaagag
agcactgtgcccaccacccaaagcagtgccatgctggccaccaaggcagctgccacccct
gagccggctatggcccagccggacagcacagccccagagggcgccacaggccaggctcca
ccctctagtaaaggggaagaggctgctggttatgcccaggagtctcaaagggaggaggcc
agctga

DBGET integrated database retrieval system