KEGG   Homo sapiens (human): 79019Help
Entry
79019             CDS       T01001                                 

Gene name
CENPM, C22orf18, CENP-M, PANE1
Definition
(RefSeq) centromere protein M
  KO
K11505  centromere protein M
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79019 (CENPM)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     79019 (CENPM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-M
Motif
Other DBs
NCBI-GeneID: 79019
NCBI-ProteinID: NP_076958
OMIM: 610152
HGNC: 18352
Ensembl: ENSG00000100162
Vega: OTTHUMG00000151277
Pharos: Q9NSP4(Tbio)
UniProt: Q9NSP4 A0A024R1Q3
Structure
PDB: 

Position
22q13.2
AA seq 180 aa AA seqDB search
MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNR
PRIDLIVFVVNLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKL
AHTYQSPLLYCDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttgaggcccctggacaagctgcccggcctgaacacggccaccatcttgctg
gtgggcacggaggatgctcttctgcagcagctggcggactcgatgctcaaagaggactgc
gcctccgagctgaaggtccacttggcaaagtccctccctttgccctccagtgtgaatcgg
ccccgaattgacctgatcgtgtttgtggttaatcttcacagcaaatacagtctccagaac
acagaggagtccctgcgccatgtggatgccagcttcttcttggggaaggtgtgtttcctc
gccacaggtgctgggcgggagagccactgcagcattcaccggcacaccgtggtgaagctg
gcccacacctatcaaagccccctgctctactgtgacctggaggtggaaggctttagggcc
accatggcgcagcgcctggtgcgcgtgctgcagatctgtgctggccacgtgcccggtgtc
tcagctctgaacctgctgtccctgctgagaagctctgagggcccctccctggaggacctg
tga

DBGET integrated database retrieval system