KEGG   Homo sapiens (human): 79023Help
Entry
79023             CDS       T01001                                 

Gene name
NUP37, MCPH24, p37
Definition
(RefSeq) nucleoporin 37
  KO
K14302  nuclear pore complex protein Nup37
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    79023 (NUP37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79023 (NUP37)
   03036 Chromosome and associated proteins [BR:hsa03036]
    79023 (NUP37)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     79023 (NUP37)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    79023 (NUP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Phage_gp49_66
Motif
Other DBs
NCBI-GeneID: 79023
NCBI-ProteinID: NP_076962
OMIM: 609264
HGNC: 29929
Ensembl: ENSG00000075188
Vega: OTTHUMG00000170478
Pharos: Q8NFH4(Tdark)
UniProt: Q8NFH4
Structure
PDB: 

Position
12q23.2
AA seq 326 aa AA seqDB search
MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEG
IQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVL
EGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFK
LMVAEKNGTIRFYDLLAQQAILSLESEQVPLMSAHWCLKNTFKVGAVAGNDWLIWDITRS
SYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGS
GLSWHRTLPLCVIGGDHKLLFWVTEV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagatgcctcaagaaatgctgcctacactgtggattgtgaagattatgtgcat
gtggtagaatttaatccctttgagaatggggattcaggaaacctaattgcatatggtggc
aataattatgtggtcattggcacgtgtacgtttcaggaagaagaagcagacgttgaaggc
attcagtataaaacacttcgaacatttcaccatggagtcagggttgatggcatagcttgg
agcccagagactagacttgattcattgcctccagtaatcaaattttgtacttcagctgct
gatatgaaaattagattatttacttcagatcttcaggataaaaatgaatataaggtttta
gagggccataccgatttcattaatggtttggtgtttgatcccaaagaaggccaagaaatt
gcaagtgtgagtgacgatcacacctgcaggatttggaacttggaaggagtgcaaacagct
cattttgttcttcattctcctggcatgagtgtgtgctggcatcctgaggagacttttaag
ctaatggttgcagagaagaatggaacaatccggttttatgatcttttggcccaacaggct
attttatctcttgaatcagaacaagtgccattaatgtcagcacactggtgcttaaaaaac
accttcaaagttggagccgttgcaggaaatgattggttaatttgggatattactcggtcc
agttatcctcaaaataagagacctgttcacatggatcgagcctgcttattcaggtggtcc
acaattagtgaaaatctgtttgcaaccactggttatcctggcaaaatggcaagccagttt
caaattcatcatttaggacaccctcagcccatcctcatgggttctgtagccgttggatct
ggactgtcctggcatcgaactctccctctgtgtgtaattggaggagaccacaagctgttg
ttttgggtgactgaagtataa

DBGET integrated database retrieval system