KEGG   Homo sapiens (human): 79036Help
Entry
79036             CDS       T01001                                 

Gene name
KXD1, BORCS4, C10orf50, C19orf50, KXDL, MST096, MSTP096
Definition
(RefSeq) KxDL motif containing 1
  KO
K20818  KxDL motif-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79036 (KXD1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    79036 (KXD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KxDL TolA_bind_tri
Motif
Other DBs
NCBI-GeneID: 79036
NCBI-ProteinID: NP_001165419
OMIM: 615178
HGNC: 28420
Ensembl: ENSG00000105700
Vega: OTTHUMG00000183107
Pharos: Q9BQD3(Tdark)
UniProt: Q9BQD3 A0A024R7M2
Position
19p13.11
AA seq 176 aa AA seqDB search
MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMS
ERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPST
TTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggacctcccggactcggcctcgagggtcttctgcggccgcatcctgagcatggtgaac
acagatgatgtcaacgccatcatcctggcccagaagaacatgctggaccgctttgagaag
accaatgagatgctgctcaacttcaacaacctgtccagtgcccgcctgcagcagatgagc
gaacgcttcctgcaccacacgaggaccctagtagagatgaaacgggacctggacagcatc
ttccgccgtatcaggacgctgaaagggaaactggccaggcagcacccagaggccttcagc
catatcccagaggcatccttcctggaggaagaggatgaagaccccatcccacccagcacc
acgaccaccattgccacctcagaacagagcacgggctcatgtgacaccagccccgacacc
gtctcgccctccctgagccccggcttcgaggacctgtcccatgtccagcctggctcccca
gccatcaacggccgcagccagacagatgacgaggagatgacgggcgaatag

DBGET integrated database retrieval system